Property Summary

NCBI Gene PubMed Count 5
Grant Count 5
R01 Count 5
Funding $334,460.4
PubMed Score 2.37
PubTator Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.021 0.002
subependymal giant cell astrocytoma -5.148 0.001

AA Sequence

MLGAKPHWLPGPLHSPGLPLVLVLLALGAGWAQEGSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPG      1 - 70
RVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGGGFDRASGSFVAPVRGVYSFRFHVVKVYNRQTVQ     71 - 140
VSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL         141 - 205
//

Text Mined References (5)

PMID Year Title
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
17030622 2006 Cbln1 is essential for interaction-dependent secretion of Cbln3.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
10964938 2000 Cbln3, a novel member of the precerebellin family that binds specifically to Cbln1.