Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.43
PubTator Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
subependymal giant cell astrocytoma 2287 1.4e-03
osteosarcoma 7950 1.5e-03

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.021 1.5e-03
subependymal giant cell astrocytoma -5.148 1.4e-03

AA Sequence

MLGAKPHWLPGPLHSPGLPLVLVLLALGAGWAQEGSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPG      1 - 70
RVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGGGFDRASGSFVAPVRGVYSFRFHVVKVYNRQTVQ     71 - 140
VSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL         141 - 205
//

Text Mined References (5)

PMID Year Title