Property Summary

NCBI Gene PubMed Count 73
Grant Count 225
R01 Count 132
Funding $32,691,453.15
PubMed Score 169.90
PubTator Score 379.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -1.200 0.001
astrocytoma 1.100 0.000
glioblastoma 2.200 0.000
oligodendroglioma 1.600 0.000
osteosarcoma 1.394 0.026
posterior fossa group A ependymoma 1.200 0.000
colon cancer -1.300 0.014
lung cancer -1.400 0.032
diabetes mellitus -1.300 0.004
pediatric high grade glioma 1.600 0.000
group 3 medulloblastoma 1.100 0.010
pilocytic astrocytoma 3.500 0.000
lung adenocarcinoma -1.100 0.000
invasive ductal carcinoma -1.100 0.024

Synonym

Accession Q6UVK1 D3DW77 Q92675
Symbols NG2
MCSP
MCSPG
MSK16
HMW-MAA
MEL-CSPG

Gene

Gene RIF (57)

PMID Text
26890881 the ratio of serum proteoglycan 4 to protease C1 inhibitor may be used for screening of early breast cancer.
26792897 These data suggest the possible involvement of GD3 and NG2 in pre/pro-tumorigenic events occurring in the complex microenvironment of the tissue surrounding glioblastoma
26340347 The NG2 proteoglycan protects oligodendrocyte precursor cells against oxidative stress via interaction with OMI/HtrA2.
26074703 The up-regulation of NG2 is associated with poor prognosis in HCC.
25713464 These data are consistent with the concept that expression of inhibitory CSPG within the injury scar is an important impediment to regeneration but that NG2+ progenitors derived from ESNLCs can modify the microenvironment
25503117 NG2 expression in pediatric brain tumors differs depending upon type and, unlike adult glioma, includes expression on lower-grade tumors.
25166220 MMP-13 overexpression or exogenous MMP-13 reduces anoikis by more effectively shedding NG2.
25016058 Describe CSPG4-specific immunotoxin that kills rhabdomyosarcoma cells and binds to primary tumor tissues.
24932730 Low CSPG4 expression is associated with pancreatic tumors.
24740185 Reduced promoter methylation and increased expression of CSPG4 are associated with head and neck squamous cell carcinomas.
More...

AA Sequence

MQSGPRPPLPAPGLALALTLTMLARLASAASFFGENHLEVPVATALTDIDLQLQFSTSQPEALLLLAAGP      1 - 70
ADHLLLQLYSGRLQVRLVLGQEELRLQTPAETLLSDSIPHTVVLTVVEGWATLSVDGFLNASSAVPGAPL     71 - 140
EVPYGLFVGGTGTLGLPYLRGTSRPLRGCLHAATLNGRSLLRPLTPDVHEGCAEEFSASDDVALGFSGPH    141 - 210
SLAAFPAWGTQDEGTLEFTLTTQSRQAPLAFQAGGRRGDFIYVDIFEGHLRAVVEKGQGTVLLHNSVPVA    211 - 280
DGQPHEVSVHINAHRLEISVDQYPTHTSNRGVLSYLEPRGSLLLGGLDAEASRHLQEHRLGLTPEATNAS    281 - 350
LLGCMEDLSVNGQRRGLREALLTRNMAAGCRLEEEEYEDDAYGHYEAFSTLAPEAWPAMELPEPCVPEPG    351 - 420
LPPVFANFTQLLTISPLVVAEGGTAWLEWRHVQPTLDLMEAELRKSQVLFSVTRGARHGELELDIPGAQA    421 - 490
RKMFTLLDVVNRKARFIHDGSEDTSDQLVLEVSVTARVPMPSCLRRGQTYLLPIQVNPVNDPPHIIFPHG    491 - 560
SLMVILEHTQKPLGPEVFQAYDPDSACEGLTFQVLGTSSGLPVERRDQPGEPATEFSCRELEAGSLVYVH    561 - 630
RGGPAQDLTFRVSDGLQASPPATLKVVAIRPAIQIHRSTGLRLAQGSAMPILPANLSVETNAVGQDVSVL    631 - 700
FRVTGALQFGELQKQGAGGVEGAEWWATQAFHQRDVEQGRVRYLSTDPQHHAYDTVENLALEVQVGQEIL    701 - 770
SNLSFPVTIQRATVWMLRLEPLHTQNTQQETLTTAHLEATLEEAGPSPPTFHYEVVQAPRKGNLQLQGTR    771 - 840
LSDGQGFTQDDIQAGRVTYGATARASEAVEDTFRFRVTAPPYFSPLYTFPIHIGGDPDAPVLTNVLLVVP    841 - 910
EGGEGVLSADHLFVKSLNSASYLYEVMERPRHGRLAWRGTQDKTTMVTSFTNEDLLRGRLVYQHDDSETT    911 - 980
EDDIPFVATRQGESSGDMAWEEVRGVFRVAIQPVNDHAPVQTISRIFHVARGGRRLLTTDDVAFSDADSG    981 - 1050
FADAQLVLTRKDLLFGSIVAVDEPTRPIYRFTQEDLRKRRVLFVHSGADRGWIQLQVSDGQHQATALLEV   1051 - 1120
QASEPYLRVANGSSLVVPQGGQGTIDTAVLHLDTNLDIRSGDEVHYHVTAGPRWGQLVRAGQPATAFSQQ   1121 - 1190
DLLDGAVLYSHNGSLSPRDTMAFSVEAGPVHTDATLQVTIALEGPLAPLKLVRHKKIYVFQGEAAEIRRD   1191 - 1260
QLEAAQEAVPPADIVFSVKSPPSAGYLVMVSRGALADEPPSLDPVQSFSQEAVDTGRVLYLHSRPEAWSD   1261 - 1330
AFSLDVASGLGAPLEGVLVELEVLPAAIPLEAQNFSVPEGGSLTLAPPLLRVSGPYFPTLLGLSLQVLEP   1331 - 1400
PQHGALQKEDGPQARTLSAFSWRMVEEQLIRYVHDGSETLTDSFVLMANASEMDRQSHPVAFTVTVLPVN   1401 - 1470
DQPPILTTNTGLQMWEGATAPIPAEALRSTDGDSGSEDLVYTIEQPSNGRVVLRGAPGTEVRSFTQAQLD   1471 - 1540
GGLVLFSHRGTLDGGFRFRLSDGEHTSPGHFFRVTAQKQVLLSLKGSQTLTVCPGSVQPLSSQTLRASSS   1541 - 1610
AGTDPQLLLYRVVRGPQLGRLFHAQQDSTGEALVNFTQAEVYAGNILYEHEMPPEPFWEAHDTLELQLSS   1611 - 1680
PPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQ   1681 - 1750
VTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHLQGPAGASVAGPQTSEA   1751 - 1820
FAITVRDVNERPPQPQASVPLRLTRGSRAPISRAQLSVVDPDSAPGEIEYEVQRAPHNGFLSLVGGGLGP   1821 - 1890
VTRFTQADVDSGRLAFVANGSSVAGIFQLSMSDGASPPLPMSLAVDILPSAIEVQLRAPLEVPQALGRSS   1891 - 1960
LSQQQLRVVSDREEPEAAYRLIQGPQYGHLLVGGRPTSAFSQFQIDQGEVVFAFTNFSSSHDHFRVLALA   1961 - 2030
RGVNASAVVNVTVRALLHVWAGGPWPQGATLRLDPTVLDAGELANRTGSVPRFRLLEGPRHGRVVRVPRA   2031 - 2100
RTEPGGSQLVEQFTQQDLEDGRLGLEVGRPEGRAPGPAGDSLTLELWAQGVPPAVASLDFATEPYNAARP   2101 - 2170
YSVALLSVPEAARTEAGKPESSTPTGEPGPMASSPEPAVAKGGFLSFLEANMFSVIIPMCLVLLLLALIL   2171 - 2240
PLLFYLRKRNKTGKHDVQVLTAKPRNGLAGDTETFRKVEPGQAIPLTAVPGQGPPPGGQPDPELLQFCRT   2241 - 2310
PNPALKNGQYWV                                                             2311 - 2322
//

Text Mined References (74)

PMID Year Title
26890881 2016 Unmasking Heavily O-Glycosylated Serum Proteins Using Perchloric Acid: Identification of Serum Proteoglycan 4 and Protease C1 Inhibitor as Molecular Indicators for Screening of Breast Cancer.
26792897 2016 Progenitor/Stem Cell Markers in Brain Adjacent to Glioblastoma: GD3 Ganglioside and NG2 Proteoglycan Expression.
26340347 2015 The NG2 Proteoglycan Protects Oligodendrocyte Precursor Cells against Oxidative Stress via Interaction with OMI/HtrA2.
26074703 2015 Neuron-glial antigen 2 overexpression in hepatocellular carcinoma predicts poor prognosis.
25713464 2015 NG2+ progenitors derived from embryonic stem cells penetrate glial scar and promote axonal outgrowth into white matter after spinal cord injury.
25503117 2014 Expression of the chondroitin sulphate proteoglycan, NG2, in paediatric brain tumors.
25166220 2014 Shedding of NG2 by MMP-13 attenuates anoikis.
25016058 2014 A CSPG4-specific immunotoxin kills rhabdomyosarcoma cells and binds to primary tumor tissues.
24932730 2014 Chondroitin sulfate proteoglycan CSPG4 as a novel hypoxia-sensitive marker in pancreatic tumors.
24740185 2014 Reduced promoter methylation and increased expression of CSPG4 negatively influences survival of HNSCC patients.
More...