Property Summary

NCBI Gene PubMed Count 72
PubMed Score 61.76
PubTator Score 153.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic -1.200 2.0e-06
glioblastoma -1.300 6.5e-10
group 3 medulloblastoma -1.200 4.0e-03
osteosarcoma 1.127 1.2e-04
pediatric high grade glioma -1.100 8.3e-06
primitive neuroectodermal tumor -1.100 5.2e-04
subependymal giant cell astrocytoma -1.003 3.5e-02

 IMPC Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (52)

AA Sequence

MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQ      1 - 70
IGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSP     71 - 140
PADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTG    141 - 210
SRPKSCEVPGINIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGN    211 - 280
LAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARRQQASPTLSPLSPITQAVAMDALSLEQQL    281 - 350
PYAFFTQAGSQQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPGGPLLPSASLTRGPQPPPLAVTVPSS    351 - 420
LPQSPPENPGQPSMGIDIASAPALQQYRTSAGSPANQSPTSPVSNQGFSPGSSPQHTSTLGSVFGDAYYE    421 - 490
QQMAARQANALSHQLEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGSHGSLPDSQQLGYASHSGIPN    491 - 560
IILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFR    561 - 630
MDRL                                                                      631 - 634
//

Text Mined References (78)

PMID Year Title