Property Summary

NCBI Gene PubMed Count 65
Grant Count 22
R01 Count 9
Funding $1,837,036.24
PubMed Score 55.18
PubTator Score 153.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.127 0.000
glioblastoma -1.300 0.000
primitive neuroectodermal tumor -1.100 0.001
pediatric high grade glioma -1.100 0.000
group 3 medulloblastoma -1.200 0.004
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.003 0.035

 IMPC Term (1)

Gene RIF (46)

PMID Text
26796488 Detection of the CRTC1/MAML2 fusion transcript provides useful information for MEC diagnosis but is not associated with differences in survival outcomes.
26503699 A specific CRTC1-MAMl2-induced transcriptional program was identified in mucoepidermoid carcinoma cells.
25465874 CRTC1 activation is a key event that drives the LKB1-null mRNA signature in lung cancer. We also identified a positive feedback LKB1/CRTC1 signaling loop for COX-2/PGE2 regulation.
25300488 This study showed that CREB-regulated transcriptional coactivator 1 (CRTC1) is required for HBV transcription and replication.
25083993 describe fundamental metabolic requirements of senescent primary human CD8+ T cells and demonstrate that p38 MAPK blockade reverses senescence via an mTOR-independent pathway
25071166 Malignant mucoepidermoid salivary gland tumors can arise from a recurrent t (11, 19)(q21;p13.1) translocation that generates an unusual chimeric CRTC1/MAML2 oncoprotein.
24771140 Translocation t(11;19)(q14-21;p12-13) in patients with Salivary mucoepidermoid carcinoma was reported , which results in fusion between exons 1 and 2 of CRTC1 on chromosome 19p13.
24468654 Lacrimal and salivary gland PAs and Ca-ex-PAs have similar genomic profiles and frequently overexpress the PLAG1 oncoprotein. Copy number gains involving 9p23-p22.3 (NFIB) and 22q12-qter (PDGFB) may be of importance for disease progression.
24121173 Metaplastic Warthin tumor and metaplastic pleomorphic adenoma of salivary glands did not harbor CRTC1-MAML2 and CRTC3-MAML2 fusion transcripts, respectively, or MAML2 gene rearrangement.
23975434 aberrantly activated AREG-EGFR signaling is required for CRTC1-MAML2-positive MEC cell growth and survival, suggesting that EGFR-targeted therapies will benefit patients with advanced, unresectable CRTC1-MAML2-positive MEC.
More...

AA Sequence

MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQ      1 - 70
IGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSP     71 - 140
PADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTG    141 - 210
SRPKSCEVPGINIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGN    211 - 280
LAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARRQQASPTLSPLSPITQAVAMDALSLEQQL    281 - 350
PYAFFTQAGSQQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPGGPLLPSASLTRGPQPPPLAVTVPSS    351 - 420
LPQSPPENPGQPSMGIDIASAPALQQYRTSAGSPANQSPTSPVSNQGFSPGSSPQHTSTLGSVFGDAYYE    421 - 490
QQMAARQANALSHQLEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGSHGSLPDSQQLGYASHSGIPN    491 - 560
IILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFR    561 - 630
MDRL                                                                      631 - 634
//

Text Mined References (71)

PMID Year Title
26796488 2016 Role of CRTC1/MAML2 Translocation in the Prognosis and Clinical Outcomes of Mucoepidermoid Carcinoma.
26503699 2015 Gene expression profiling analysis of CRTC1-MAML2 fusion oncogene-induced transcriptional program in human mucoepidermoid carcinoma cells.
25465874 2015 Role of LKB1-CRTC1 on glycosylated COX-2 and response to COX-2 inhibition in lung cancer.
25300488 2014 Requirement of CRTC1 coactivator for hepatitis B virus transcription.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25083993 2014 p38 signaling inhibits mTORC1-independent autophagy in senescent human CD8? T cells.
25071166 2014 CRTC1/MAML2 gain-of-function interactions with MYC create a gene signature predictive of cancers with CREB-MYC involvement.
25057126 2014 Meta-analysis identifies loci affecting levels of the potential osteoarthritis biomarkers sCOMP and uCTX-II with genome wide significance.
24771140 2015 Salivary mucoepidermoid carcinoma revisited.
24468654 2014 Lacrimal gland pleomorphic adenoma and carcinoma ex pleomorphic adenoma: genomic profiles, gene fusions, and clinical characteristics.
More...