Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.02
PubTator Score 4.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.3e-04
ependymoma 1.100 2.1e-02
medulloblastoma, large-cell 1.400 2.1e-05
oligodendroglioma 1.300 4.5e-03
osteosarcoma -1.808 5.7e-05
ovarian cancer -1.200 6.1e-05
sonic hedgehog group medulloblastoma 1.300 5.5e-04

Gene RIF (5)

AA Sequence

MAAPSGVHLLVRRGSHRIFSSPLNHIYLHKQSSSQQRRNFFFRRQRDISHSIVLPAAVSSAHPVPKHIKK      1 - 70
PDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPS     71 - 140
PLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVA    141 - 210
RRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMA    211 - 280
FTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEA                   281 - 335
//

Text Mined References (13)

PMID Year Title