Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.93
PubTator Score 4.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
medulloblastoma, large-cell 6234 2.13624274287657E-5
osteosarcoma 7933 5.65108953487689E-5
ovarian cancer 8492 6.06483482565058E-5
atypical teratoid / rhabdoid tumor 4369 1.27401774465335E-4
sonic hedgehog group medulloblastoma 1482 5.54223702885807E-4
oligodendroglioma 2849 0.00454982506402138
ependymoma 2514 0.0209328929101104

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.100 0.021
oligodendroglioma 1.300 0.005
osteosarcoma -1.808 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
medulloblastoma, large-cell 1.400 0.000
sonic hedgehog group medulloblastoma 1.300 0.001
ovarian cancer -1.200 0.000

Synonym

Accession Q6UB28 Q1WNX3 MAP 1D
Symbols MAP1D
MAP 1D
Metap1l
MetAP 1D

Gene

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (5)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
16568094 MAP1D is a potentially oncogenic, novel member of the MAP gene family that may play an important role in colon tumorigenesis

AA Sequence

MAAPSGVHLLVRRGSHRIFSSPLNHIYLHKQSSSQQRRNFFFRRQRDISHSIVLPAAVSSAHPVPKHIKK      1 - 70
PDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPS     71 - 140
PLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVA    141 - 210
RRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMA    211 - 280
FTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEA                   281 - 335
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17929833 2007 Kinetic and mutational studies of the number of interacting divalent cations required by bacterial and human methionine aminopeptidases.
16568094 2006 MAP1D, a novel methionine aminopeptidase family member is overexpressed in colon cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...