Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.20
PubTator Score 24.05

Knowledge Summary

Patent (6,747)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Gene RIF (6)

AA Sequence

MALNHTALPQDERLPHYLRDGDPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEI      1 - 70
MTINLAVCDLGISVVGKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICYLSY     71 - 140
GVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLL    141 - 210
PTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRP    211 - 280
DSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIH    281 - 350
EEWE                                                                      351 - 354
//

Text Mined References (16)

PMID Year Title