Property Summary

NCBI Gene PubMed Count 4
PubMed Score 11.90
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 7.4e-05
group 4 medulloblastoma 1855 8.5e-03
adult high grade glioma 3801 1.2e-02
Disease Target Count Z-score Confidence
Pseudohypoparathyroidism 18 3.005 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.100 1.2e-02
group 4 medulloblastoma 1.100 8.5e-03
psoriasis -1.200 7.4e-05

AA Sequence

MISTKEKNKIPKDSMTLLPCFYFVELPIVASSIVSLYFLELTDLFKPAKVGFQCYDRTLSMPYVETNEEL      1 - 70
IPLLMLLSLAFAAPAASIMVAEGMLYCLQSRLWGRAGGPAGAEGSINAGGCNFNSFLRRTVRFVGVHVFG     71 - 140
LCATALVTDVIQLATGYHTPFFLTVCKPNYTLLGTSCEVNPYITQDICSGHDIHAILSARKTFPSQHATL    141 - 210
SAFAAVYVSMYFNSVISDTTKLLKPILVFAFAIAAGVCGLTQITQYRSHPVDVYAGFLIGAGIAAYLACH    211 - 280
AVGNFQAPPAEKPAAPAPAKDALRALTQRGHDSVYQQNKSVSTDELGPPGRLEGAPRPVAREKTSLGSLK    281 - 350
RASVDVDLLAPRSPMAKENMVTFSHTLPRASAPSLDDPARRHMTIHVPLDASRSKQLISEWKQKSLEGRG    351 - 420
LGLPDDASPGHLRAPAEPMAEEEEEEEDEEEEEEEEEEEDEGPAPPSLYPTVQARPGLGPRVILPPRAGP    421 - 490
PPLVHIPEEGAQTGAGLSPKSGAGVRAKWLMMAEKSGAAVANPPRLLQVIAMSKAPGAPGPKAAETASSS    491 - 560
SASSDSSQYRSPSDRDSASIVTIDAHAPHHPVVHLSAGGAPWEWKAAGGGAKAEADGGYELGDLARGFRG    561 - 630
GAKPPGVSPGSSVSDVDQEEPRFGAVATVNLATGEGLPPLGAADGALGPGSRESTLRRHAGGLGLAEREA    631 - 700
EAEAEGYFRKMQARRFPD                                                        701 - 718
//

Text Mined References (5)

PMID Year Title