Property Summary

NCBI Gene PubMed Count 5
Grant Count 23
R01 Count 18
Funding $2,437,843.09
PubMed Score 42.70
PubTator Score 25.05

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976975 Knockdown of TATA box binding protein like 2 (TBPL2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17704303 Here we report that differentiation of myoblast to myotubes involves the disruption of the canonical holo-TFIID and replacement by a novel TRF3/TAF3 (TBP-related factor 3/TATA-binding protein-associated factor 3) complex.
14634207 TRF3 is a nuclear protein that is present in all human and mouse tissues and cell lines examined

AA Sequence

MASAPWPERVPRLLAPRLPSYPPPPPTVGLRSMEQEETYLELYLDQCAAQDGLAPPRSPLFSPVVPYDMY      1 - 70
ILNASNPDTAFNSNPEVKETSGDFSSVDLSFLPDEVTQENKDQPVISKHETEENSESQSPQSRLPSPSEQ     71 - 140
DVGLGLNSSSLSNSHSQLHPGDTDSVQPSPEKPNSDSLSLASITPMTPMTPISECCGIVPQLQNIVSTVN    141 - 210
LACKLDLKKIALHAKNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQK    211 - 280
LGFPARFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLT    281 - 350
GAKERSEIYEAFENIYPILKGFKKA                                                 351 - 375
//

Text Mined References (6)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17704303 2007 Switching of the core transcription machinery during myogenesis.
17570761 2007 Genomics, evolution, and expression of TBPL2, a member of the TBP family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14634207 2003 TRF3, a TATA-box-binding protein-related factor, is vertebrate-specific and widely expressed.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.