Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.12
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6S545 A2CEK4 A6NCI1 A9Z1W0
Symbols A26C3
ACTBL1
POTE22
CT104.7

Gene

 Compartment GO Term (0)

AA Sequence

MVAEAGSMPAASSVKKPFGLRSKMGKWCRHCFAWCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCCHCFP      1 - 70
WCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCCHCFPCCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCC     71 - 140
HCFPCCRGSGKNKVGPWGDYDDSAFMEPRYHVRREDLDKLHRAAWWGKVPRKDLIVMLKDTDMNKKDKQK    141 - 210
RTALHLASANGNSEVVKLLLDRRCQLNILDNKKRTALTKAVQCQEDECALMLLEHGTDPNIPDEYGNTAL    211 - 280
HYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGVHEQKQQVVKFLIKKKANLNALDRYGRTALILAV    281 - 350
CCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSRHNVICQLLSDYKEKQILKVSSENSNPEQDLKLTS    351 - 420
EEESQRLKGSENSQPEEMSQEPEINKGGDRKVEEEMKKHGSTHMGFPENLTNGATADNGDDGLIPPRKSR    421 - 490
TPESQQFPDTENEQYHSDEQNDTQKQLSEEQNTGILQDEILIHEEKQIEVAENEF                   491 - 545
//

Text Mined References (4)

PMID Year Title