Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.12
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6S545 A2CEK4 A6NCI1 A9Z1W0
Symbols A26C3
ACTBL1
POTE22
CT104.7

Gene

 Compartment GO Term (0)

AA Sequence

MVAEAGSMPAASSVKKPFGLRSKMGKWCRHCFAWCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCCHCFP      1 - 70
WCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCCHCFPCCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCC     71 - 140
HCFPCCRGSGKNKVGPWGDYDDSAFMEPRYHVRREDLDKLHRAAWWGKVPRKDLIVMLKDTDMNKKDKQK    141 - 210
RTALHLASANGNSEVVKLLLDRRCQLNILDNKKRTALTKAVQCQEDECALMLLEHGTDPNIPDEYGNTAL    211 - 280
HYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGVHEQKQQVVKFLIKKKANLNALDRYGRTALILAV    281 - 350
CCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSRHNVICQLLSDYKEKQILKVSSENSNPEQDLKLTS    351 - 420
EEESQRLKGSENSQPEEMSQEPEINKGGDRKVEEEMKKHGSTHMGFPENLTNGATADNGDDGLIPPRKSR    421 - 490
TPESQQFPDTENEQYHSDEQNDTQKQLSEEQNTGILQDEILIHEEKQIEVAENEF                   491 - 545
//

Text Mined References (4)

PMID Year Title
21439273 2011 POTEH hypomethylation, a new epigenetic biomarker for glioma prognosis.
15276201 2004 Five POTE paralogs and their splice variants are expressed in human prostate and encode proteins of different lengths.
12475935 2002 POTE, a highly homologous gene family located on numerous chromosomes and expressed in prostate, ovary, testis, placenta, and prostate cancer.
10591208 1999 The DNA sequence of human chromosome 22.