Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.95
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

Synonym

Accession Q6RVD6 Q2KJ07
Symbols SRG8

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MAPAGMSGAQDNSCLYQEIAPSFQRLPCPRTSSRHFSEAMTCPCGWRPFKGGPGGLKGPVWPAKEENSCS      1 - 70
HGRIQRVQRRRVPSASPLIQKINRRSVLFHPYCWS                                        71 - 105
//

Text Mined References (11)

PMID Year Title