Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.95
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6RVD6 Q2KJ07
Symbols SRG8

Gene

 Compartment GO Term (0)

AA Sequence

MAPAGMSGAQDNSCLYQEIAPSFQRLPCPRTSSRHFSEAMTCPCGWRPFKGGPGGLKGPVWPAKEENSCS      1 - 70
HGRIQRVQRRRVPSASPLIQKINRRSVLFHPYCWS                                        71 - 105
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25293881 2015 The contribution of common genetic variation to nicotine and cotinine glucuronidation in multiple ethnic/racial populations.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16809841 2006 Molecular cloning and characterization of a novel human testis-specific gene by use of digital differential display.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.