Property Summary

NCBI Gene PubMed Count 6
PubMed Score 10.13
PubTator Score 60.53

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6RSH7 A1L4M4 VHL-like protein
Symbols VLP
VHLP

Gene

AA Sequence

MPWRAGNGVGLEAQAGTQEAGPEEYCQEELGAEEEMAARAAWPVLRSVNSRELSRIIICNHSPRIVLPVW      1 - 70
LNYYGKLLPYLTLLPGRDFRIHNFRSHPWLFRDARTHDKLLVNQTELFVPSSNVNGQPVFANITLQCIP      71 - 139
//

Text Mined References (7)

PMID Year Title