Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.13
PubTator Score 60.53

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q6RSH7 A1L4M4 VHL-like protein
Symbols VLP
VHLP

Gene

AA Sequence

MPWRAGNGVGLEAQAGTQEAGPEEYCQEELGAEEEMAARAAWPVLRSVNSRELSRIIICNHSPRIVLPVW      1 - 70
LNYYGKLLPYLTLLPGRDFRIHNFRSHPWLFRDARTHDKLLVNQTELFVPSSNVNGQPVFANITLQCIP      71 - 139
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14757845 2004 Molecular cloning and characterization of the von Hippel-Lindau-like protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10475385 1999 Processed pseudogene from the von Hippel-Lindau disease gene is located on human chromosome 1.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.