Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.25
PubTator Score 6.89

Knowledge Summary

Patent (842)

Expression

Gene RIF (6)

PMID Text
23166591 Expression of HIV-1 Tat downregulates the abundance of G protein-coupled receptor 133 (GPR133) in the nucleoli of Jurkat T-cells
22025619 Cell adhesion receptor GPR133 couples to Gs protein
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20031603 A role for GPR133 protein in affecting the length of the electrocardiographic RR interval and heart rate.
20031603 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19729412 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MEKLLRLCCWYSWLLLFYYNFQVRGVYSRSQDHPGFQVLASASHYWPLENVDGIHELQDTTGDIVEGKVN      1 - 70
KGIYLKEEKGVTLLYYGRYNSSCISKPEQCGPEGVTFSFFWKTQGEQSRPIPSAYGGQVISNGFKVCSSG     71 - 140
GRGSVELYTRDNSMTWEASFSPPGPYWTHVLFTWKSKEGLKVYVNGTLSTSDPSGKVSRDYGESNVNLVI    141 - 210
GSEQDQAKCYENGAFDEFIIWERALTPDEIAMYFTAAIGKHALLSSTLPSLFMTSTASPVMPTDAYHPII    211 - 280
TNLTEERKTFQSPGVILSYLQNVSLSLPSKSLSEQTALNLTKTFLKAVGEILLLPGWIALSEDSAVVLSL    281 - 350
IDTIDTVMGHVSSNLHGSTPQVTVEGSSAMAEFSVAKILPKTVNSSHYRFPAHGQSFIQIPHEAFHRHAW    351 - 420
STVVGLLYHSMHYYLNNIWPAHTKIAEAMHHQDCLLFATSHLISLEVSPPPTLSQNLSGSPLITVHLKHR    421 - 490
LTRKQHSEATNSSNRVFVYCAFLDFSSGEGVWSNHGCALTRGNLTYSVCRCTHLTNFAILMQVVPLELAR    491 - 560
GHQVALSSISYVGCSLSVLCLVATLVTFAVLSSVSTIRNQRYHIHANLSFAVLVAQVLLLISFRLEPGTT    561 - 630
PCQVMAVLLHYFFLSAFAWMLVEGLHLYSMVIKVFGSEDSKHRYYYGMGWGFPLLICIISLSFAMDSYGT    631 - 700
SNNCWLSLASGAIWAFVAPALFVIVVNIGILIAVTRVISQISADNYKIHGDPSAFKLTAKAVAVLLPILG    701 - 770
TSWVFGVLAVNGCAVVFQYMFATLNSLQGLFIFLFHCLLNSEVRAAFKHKTKVWSLTSSSARTSNAKPFH    771 - 840
SDLMNGTRPGMASTKLSPWDKSSHSAHRVDLSAV                                        841 - 874
//

Text Mined References (16)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
25533341 2014 A tethered agonist within the ectodomain activates the adhesion G protein-coupled receptors GPR126 and GPR133.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
22575658 2012 Signaling property study of adhesion G-protein-coupled receptors.
22025619 2011 Cell adhesion receptor GPR133 couples to Gs protein.
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20031603 2009 A genome-wide association scan of RR and QT interval duration in 3 European genetically isolated populations: the EUROSPAN project.
19729412 2009 Genetic variation in GPR133 is associated with height: genome wide association study in the self-contained population of Sorbs.
16541075 2006 The finished DNA sequence of human chromosome 12.
More...