Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.75
PubTator Score 6.89

Knowledge Summary

Patent (842)

Expression

  Differential Expression (15)

Disease log2 FC p
Atopic dermatitis -2.000 6.3e-05
Breast cancer -1.400 4.3e-02
ductal carcinoma in situ -1.800 1.7e-02
ependymoma 1.700 5.2e-03
intraductal papillary-mucinous adenoma (... -1.600 5.3e-04
intraductal papillary-mucinous carcinoma... -2.000 1.6e-04
intraductal papillary-mucinous neoplasm ... -2.100 2.0e-03
invasive ductal carcinoma -2.500 1.5e-02
lung adenocarcinoma -1.300 6.5e-11
lung carcinoma -2.100 9.0e-20
medulloblastoma, large-cell -1.100 3.0e-04
non-small cell lung cancer -2.861 1.4e-20
ovarian cancer -5.500 2.4e-20
pancreatic ductal adenocarcinoma liver m... -1.010 7.4e-03
pituitary cancer -1.300 1.3e-04

Gene RIF (8)

AA Sequence

MEKLLRLCCWYSWLLLFYYNFQVRGVYSRSQDHPGFQVLASASHYWPLENVDGIHELQDTTGDIVEGKVN      1 - 70
KGIYLKEEKGVTLLYYGRYNSSCISKPEQCGPEGVTFSFFWKTQGEQSRPIPSAYGGQVISNGFKVCSSG     71 - 140
GRGSVELYTRDNSMTWEASFSPPGPYWTHVLFTWKSKEGLKVYVNGTLSTSDPSGKVSRDYGESNVNLVI    141 - 210
GSEQDQAKCYENGAFDEFIIWERALTPDEIAMYFTAAIGKHALLSSTLPSLFMTSTASPVMPTDAYHPII    211 - 280
TNLTEERKTFQSPGVILSYLQNVSLSLPSKSLSEQTALNLTKTFLKAVGEILLLPGWIALSEDSAVVLSL    281 - 350
IDTIDTVMGHVSSNLHGSTPQVTVEGSSAMAEFSVAKILPKTVNSSHYRFPAHGQSFIQIPHEAFHRHAW    351 - 420
STVVGLLYHSMHYYLNNIWPAHTKIAEAMHHQDCLLFATSHLISLEVSPPPTLSQNLSGSPLITVHLKHR    421 - 490
LTRKQHSEATNSSNRVFVYCAFLDFSSGEGVWSNHGCALTRGNLTYSVCRCTHLTNFAILMQVVPLELAR    491 - 560
GHQVALSSISYVGCSLSVLCLVATLVTFAVLSSVSTIRNQRYHIHANLSFAVLVAQVLLLISFRLEPGTT    561 - 630
PCQVMAVLLHYFFLSAFAWMLVEGLHLYSMVIKVFGSEDSKHRYYYGMGWGFPLLICIISLSFAMDSYGT    631 - 700
SNNCWLSLASGAIWAFVAPALFVIVVNIGILIAVTRVISQISADNYKIHGDPSAFKLTAKAVAVLLPILG    701 - 770
TSWVFGVLAVNGCAVVFQYMFATLNSLQGLFIFLFHCLLNSEVRAAFKHKTKVWSLTSSSARTSNAKPFH    771 - 840
SDLMNGTRPGMASTKLSPWDKSSHSAHRVDLSAV                                        841 - 874
//

Text Mined References (18)

PMID Year Title