Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.25
PubTator Score 6.89

Knowledge Summary

Patent (842)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.41605303258063E-20
ovarian cancer 8492 2.36487521668518E-20
lung carcinoma 2844 8.98714861773535E-20
lung adenocarcinoma 2714 2.15861723526847E-12
posterior fossa group A ependymoma 1511 4.34966295684527E-11
Atopic dermatitis 944 6.33560374698999E-5
pituitary cancer 1972 1.28764374182437E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.58049388531606E-4
medulloblastoma, large-cell 6234 2.95692067022339E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.26308689541132E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00197463597861385
pancreatic ductal adenocarcinoma liver metastasis 1795 0.007408691264573
invasive ductal carcinoma 2950 0.0152098911979229
ductal carcinoma in situ 1745 0.0172045644977456
Breast cancer 3099 0.0429151332971194
Disease Target Count Z-score Confidence
Heart conduction disease 65 0.0 2.0

Expression

Synonym

Accession Q6QNK2 B2CKK9 B7ZLF7 Q2M1L3 Q6ZMQ1 Q7Z7M2 Q86SM4
Symbols PGR25
GPR133

Gene

  Ortholog (2)

Species Source
Mouse EggNOG Inparanoid
Cow EggNOG Inparanoid

Pathway (1)

Gene RIF (6)

PMID Text
23166591 Expression of HIV-1 Tat downregulates the abundance of G protein-coupled receptor 133 (GPR133) in the nucleoli of Jurkat T-cells
22025619 Cell adhesion receptor GPR133 couples to Gs protein
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20031603 A role for GPR133 protein in affecting the length of the electrocardiographic RR interval and heart rate.
20031603 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19729412 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MEKLLRLCCWYSWLLLFYYNFQVRGVYSRSQDHPGFQVLASASHYWPLENVDGIHELQDTTGDIVEGKVN      1 - 70
KGIYLKEEKGVTLLYYGRYNSSCISKPEQCGPEGVTFSFFWKTQGEQSRPIPSAYGGQVISNGFKVCSSG     71 - 140
GRGSVELYTRDNSMTWEASFSPPGPYWTHVLFTWKSKEGLKVYVNGTLSTSDPSGKVSRDYGESNVNLVI    141 - 210
GSEQDQAKCYENGAFDEFIIWERALTPDEIAMYFTAAIGKHALLSSTLPSLFMTSTASPVMPTDAYHPII    211 - 280
TNLTEERKTFQSPGVILSYLQNVSLSLPSKSLSEQTALNLTKTFLKAVGEILLLPGWIALSEDSAVVLSL    281 - 350
IDTIDTVMGHVSSNLHGSTPQVTVEGSSAMAEFSVAKILPKTVNSSHYRFPAHGQSFIQIPHEAFHRHAW    351 - 420
STVVGLLYHSMHYYLNNIWPAHTKIAEAMHHQDCLLFATSHLISLEVSPPPTLSQNLSGSPLITVHLKHR    421 - 490
LTRKQHSEATNSSNRVFVYCAFLDFSSGEGVWSNHGCALTRGNLTYSVCRCTHLTNFAILMQVVPLELAR    491 - 560
GHQVALSSISYVGCSLSVLCLVATLVTFAVLSSVSTIRNQRYHIHANLSFAVLVAQVLLLISFRLEPGTT    561 - 630
PCQVMAVLLHYFFLSAFAWMLVEGLHLYSMVIKVFGSEDSKHRYYYGMGWGFPLLICIISLSFAMDSYGT    631 - 700
SNNCWLSLASGAIWAFVAPALFVIVVNIGILIAVTRVISQISADNYKIHGDPSAFKLTAKAVAVLLPILG    701 - 770
TSWVFGVLAVNGCAVVFQYMFATLNSLQGLFIFLFHCLLNSEVRAAFKHKTKVWSLTSSSARTSNAKPFH    771 - 840
SDLMNGTRPGMASTKLSPWDKSSHSAHRVDLSAV                                        841 - 874
//

Text Mined References (16)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
25533341 2014 A tethered agonist within the ectodomain activates the adhesion G protein-coupled receptors GPR126 and GPR133.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
22575658 2012 Signaling property study of adhesion G-protein-coupled receptors.
22025619 2011 Cell adhesion receptor GPR133 couples to Gs protein.
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20031603 2009 A genome-wide association scan of RR and QT interval duration in 3 European genetically isolated populations: the EUROSPAN project.
19729412 2009 Genetic variation in GPR133 is associated with height: genome wide association study in the self-contained population of Sorbs.
16541075 2006 The finished DNA sequence of human chromosome 12.
More...