Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.26
PubTator Score 0.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.000 1.3e-05
Alzheimer's disease -1.200 3.1e-02
astrocytoma -1.100 1.3e-12
Astrocytoma, Pilocytic -2.400 2.0e-10
atypical teratoid / rhabdoid tumor -2.000 2.3e-06
ependymoma -1.700 1.6e-06
glioblastoma -2.000 6.5e-10
group 3 medulloblastoma -2.600 1.8e-05
medulloblastoma, large-cell -2.400 3.7e-04
Pick disease -1.700 9.2e-06
pituitary cancer 1.200 1.7e-03
primitive neuroectodermal tumor -1.700 9.7e-03
progressive supranuclear palsy -1.100 1.3e-02

AA Sequence

MSRRVVRQSKFRHVFGQAAKADQAYEDIRVSKVTWDSSFCAVNPKFLAIIVEAGGGGAFIVLPLAKTGRV      1 - 70
DKNYPLVTGHTAPVLDIDWCPHNDNVIASASDDTTIMVWQIPDYTPMRNITEPIITLEGHSKRVGILSWH     71 - 140
PTARNVLLSAGGDNVIIIWNVGTGEVLLSLDDMHPDVIHSVCWNSNGSLLATTCKDKTLRIIDPRKGQVV    141 - 210
AEQARPHEGARPLRAVFTADGKLLSTGFSRMSERQLALWDPNNFEEPVALQEMDTSNGVLLPFYDPDSSI    211 - 280
VYLCGKGDSSIRYFEITDEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMT    281 - 350
VPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPR    351 - 420
RSQSASDAPLSQQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTD                      421 - 472
//

Text Mined References (10)

PMID Year Title