Property Summary

NCBI Gene PubMed Count 34
Grant Count 3
Funding $101,354.01
PubMed Score 47.53
PubTator Score 38.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -2.400 0.000
ependymoma -4.100 0.000
glioblastoma -3.600 0.000
oligodendroglioma -2.200 0.000
group 3 medulloblastoma -2.800 0.001
atypical teratoid / rhabdoid tumor -3.900 0.000
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -2.400 0.000
lung cancer 4.500 0.000
pediatric high grade glioma -3.500 0.000
pilocytic astrocytoma -3.900 0.000
subependymal giant cell astrocytoma -3.587 0.003
lung carcinoma 3.500 0.000
Pick disease -1.100 0.048
psoriasis -1.800 0.000

Synonym

Accession Q6PUV4 B2RAG2 O09056 Q13329 Q28184 Q52M15 Q64386
Symbols CPX2
Hfb1
921-L
CPX-2

Gene

Gene RIF (14)

PMID Text
25692331 These results suggested that CPLX2 participated in synaptic taste transduction.
25564026 CPLX2 rs1366116*T variant represents a risk factor of schizophrenia, and , at the same time, CPLX2 rs3892909*T variant is protective against schizophrenia (study performed in Armenians).
25297695 Then results indicated that CPLX2 may be involved in the etiology of schizophrenia and one of its potential biological mechanisms by studying the effects of CPLX2 risk variants on working memory load-dependent neural activity in a frontoparietal network.
20819981 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
18240322 CX2 level increased between the fetal and the 6-10 years groups and then plateaued
16442780 Observational study of gene-disease association. (HuGE Navigator)
16131404 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKY      1 - 70
GLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK           71 - 134
//

Text Mined References (34)

PMID Year Title
25692331 2015 Expression of the synaptic exocytosis-regulating molecule complexin 2 in taste buds and its participation in peripheral taste transduction.
25564026 2014 Risk and protective effects of the complexin-2 gene and gene-environment interactions in schizophrenia.
25297695 2015 Complexin2 modulates working memory-related neural activity in patients with schizophrenia.
24951543 2014 Meta-analysis of genome-wide association studies in multiethnic Asians identifies two loci for age-related nuclear cataract.
23527680 2013 Genome-wide association study of inattention and hyperactivity-impulsivity measured as quantitative traits.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20819981 2010 Modification of cognitive performance in schizophrenia by complexin 2 gene polymorphisms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
More...