Property Summary

NCBI Gene PubMed Count 35
PubMed Score 49.58
PubTator Score 38.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.200 2.0e-04
astrocytic glioma -1.900 3.1e-03
Astrocytoma, Pilocytic -1.800 1.2e-05
atypical teratoid / rhabdoid tumor -2.500 7.7e-11
ependymoma -2.200 3.4e-03
glioblastoma -1.700 1.3e-07
group 3 medulloblastoma -2.800 5.9e-04
lung cancer 4.500 1.6e-06
lung carcinoma 3.500 2.2e-49
medulloblastoma, large-cell -2.500 4.9e-05
oligodendroglioma -2.200 1.1e-14
Pick disease -1.100 4.8e-02
primitive neuroectodermal tumor -1.900 1.1e-03
psoriasis -1.800 6.5e-08
subependymal giant cell astrocytoma -3.587 3.1e-03

Gene RIF (15)

AA Sequence

MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKY      1 - 70
GLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK           71 - 134
//

Text Mined References (35)

PMID Year Title