Property Summary

NCBI Gene PubMed Count 29
PubMed Score 19.15
PubTator Score 12.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.7e-05
dermatomyositis 966 1.9e-04
osteosarcoma 7950 2.1e-04
medulloblastoma, large-cell 6241 4.3e-04
psoriasis 6694 4.4e-04
astrocytoma 1146 3.9e-03
lung cancer 4740 1.1e-02
adult high grade glioma 3801 2.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.100 2.0e-02
astrocytoma 1.500 3.9e-03
dermatomyositis -1.100 1.9e-04
lung cancer 1.300 1.1e-02
medulloblastoma, large-cell 1.500 4.3e-04
osteosarcoma -1.592 2.1e-04
ovarian cancer 1.800 2.7e-05
psoriasis -1.800 4.4e-04

Gene RIF (11)

AA Sequence

MATQVEPLLPGGATLLQAEEHGGLVRKKPPPAPEGKGEPGPNDVRGGEPDGSARRPRPPCAKPHKEGTGQ      1 - 70
QERESPRPLQLPGAEGPAISDGEEGGGEPGAGGGAAGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVN     71 - 140
GQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKDMKEQE    141 - 210
KGEGSDSKESPKTKSDESGEEKNGDEDCQRGGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRH    211 - 280
IPANRGEIKGSESATYVPVAPPTPAWQPEIKPEPAWHDQDETSSVKSDGAGGARASFRGRGRGRGRGRGR    281 - 350
GRGGTRTHFDYQFGYRKFDGVEGPRTPKYMNNITYYFDNVSSTELYSVDQELLKDYIKRQIEYYFSVDNL    351 - 420
ERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPPIVD    421 - 490
YSQTDFSQLLNCPEFVPRQHYQKETESAPGSPRAVTPVPTKTEEVSNLKTLPKGLSASLPDLDSENWIEV    491 - 560
KKRPRPSPARPKKSEESRFSHLTSLPQQLPSQQLMSKDQDEQEELDFLFDEEMEQMDGRKNTFTAWSDEE    561 - 630
SDYEIDDRDVNKILIVTQTPHYMRRHPGGDRTGNHTSRAKMSAELAKVINDGLFYYEQDLWAEKFEPEYS    631 - 700
QIKQEVENFKKVNMISREQFDTLTPEPPVDPNQEVPPGPPRFQQVPTDALANKLFGAPEPSTIARSLPTT    701 - 770
VPESPNYRNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPPLESHVGWVMDSRE    771 - 840
HRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQ    841 - 910
EMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVK    911 - 980
DYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEG    981 - 1050
RKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK                           1051 - 1096
//

Text Mined References (50)

PMID Year Title