Property Summary

NCBI Gene PubMed Count 28
Grant Count 2
R01 Count 1
Funding $262,212.84
PubMed Score 15.43
PubTator Score 12.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.800 0.000
osteosarcoma -1.592 0.000
astrocytoma 1.500 0.004
medulloblastoma, large-cell 1.500 0.000
lung cancer 1.800 0.000
adult high grade glioma -1.100 0.020
ovarian cancer 1.800 0.000
dermatomyositis -1.100 0.000

Synonym

Accession Q6PKG0 O94836 Q8N4M2 Q8NB73 Q9UFD7
Symbols LARP

Gene

 Grant Application (2)

PDB

4ZC4   5C0V  

Gene RIF (10)

PMID Text
26717985 Data indicate that RNA-binding protein LARP1 promotes ovarian cancer progression and chemotherapy resistance.
26206669 The first evidence that the DM15 region of human LARP1 mediates its RNA binding activity.
26063484 Data showed that LARP1 was upregulated in prostate cancer (PCa) and contributed to cancer cell invasion, indicating that it functioned as an oncogene. Its 3'UTR is the binding site for miR-26a and miR-26b.
25940091 LARP1 is a target of mTORC1 that associates with TOP mRNAs via their 5'TOP motif to repress their translation.
25631074 Cellular biotinylated La ribonucleoprotein domain family, member 1 (LARP1) protein is incorporated into HIV-1 Gag virus-like particles
25531318 conclude that, through the post-transcriptional regulation of genes such as mTOR within cancer pathways, LARP1 contributes to cancer progression
25010285 Cellular biotinylated La ribonucleoprotein domain family, member 1 (LARP1) protein is incorporated into HIV-1 Gag virus-like particles
24532714 LARP1 associates with actively translating ribosomes via PABP and that LARP1 stimulates the translation of mRNAs containing a 5' terminal oligopyrimidine (TOP) motif
23711370 LARP1 may be involved in the post-transcriptional regulation of gene expression through the binding to 3' terminus of the poly(A) tail.
15060081 Nuclear trafficking of La protein depends on a newly identified nucleolar localization signal and the ability to bind RNA

AA Sequence

MATQVEPLLPGGATLLQAEEHGGLVRKKPPPAPEGKGEPGPNDVRGGEPDGSARRPRPPCAKPHKEGTGQ      1 - 70
QERESPRPLQLPGAEGPAISDGEEGGGEPGAGGGAAGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVN     71 - 140
GQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKDMKEQE    141 - 210
KGEGSDSKESPKTKSDESGEEKNGDEDCQRGGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRH    211 - 280
IPANRGEIKGSESATYVPVAPPTPAWQPEIKPEPAWHDQDETSSVKSDGAGGARASFRGRGRGRGRGRGR    281 - 350
GRGGTRTHFDYQFGYRKFDGVEGPRTPKYMNNITYYFDNVSSTELYSVDQELLKDYIKRQIEYYFSVDNL    351 - 420
ERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPPIVD    421 - 490
YSQTDFSQLLNCPEFVPRQHYQKETESAPGSPRAVTPVPTKTEEVSNLKTLPKGLSASLPDLDSENWIEV    491 - 560
KKRPRPSPARPKKSEESRFSHLTSLPQQLPSQQLMSKDQDEQEELDFLFDEEMEQMDGRKNTFTAWSDEE    561 - 630
SDYEIDDRDVNKILIVTQTPHYMRRHPGGDRTGNHTSRAKMSAELAKVINDGLFYYEQDLWAEKFEPEYS    631 - 700
QIKQEVENFKKVNMISREQFDTLTPEPPVDPNQEVPPGPPRFQQVPTDALANKLFGAPEPSTIARSLPTT    701 - 770
VPESPNYRNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPPLESHVGWVMDSRE    771 - 840
HRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQ    841 - 910
EMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVK    911 - 980
DYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEG    981 - 1050
RKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK                           1051 - 1096
//

Text Mined References (48)

PMID Year Title
26735137 2016 Characterization of RyDEN (C19orf66) as an Interferon-Stimulated Cellular Inhibitor against Dengue Virus Replication.
26717985 2016 The RNA-binding protein LARP1 is a post-transcriptional regulator of survival and tumorigenesis in ovarian cancer.
26206669 2015 The La-related protein 1-specific domain repurposes HEAT-like repeats to directly bind a 5'TOP sequence.
26063484 2015 MicroRNA-26a/b directly regulate La-related protein 1 and inhibit cancer cell invasion in prostate cancer.
25940091 2015 La-related Protein 1 (LARP1) Represses Terminal Oligopyrimidine (TOP) mRNA Translation Downstream of mTOR Complex 1 (mTORC1).
25531318 2015 LARP1 post-transcriptionally regulates mTOR and contributes to cancer progression.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24532714 2014 Proteomic analysis of cap-dependent translation identifies LARP1 as a key regulator of 5'TOP mRNA translation.
More...