Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.100 3.2e-03
Astrocytoma, Pilocytic 1.500 2.3e-06
atypical teratoid/rhabdoid tumor 1.200 9.2e-05
breast carcinoma 1.200 1.3e-02
dermatomyositis 1.100 1.9e-03
ependymoma 1.200 3.1e-08
glioblastoma 1.400 5.8e-06
intraductal papillary-mucinous neoplasm ... -1.300 9.1e-03
lung cancer 1.500 3.9e-03
malignant mesothelioma -1.200 6.0e-06
Multiple myeloma 1.117 4.9e-03
ovarian cancer 1.900 7.3e-04
pituitary cancer 1.300 6.8e-05
subependymal giant cell astrocytoma 1.513 7.0e-03
tuberculosis 1.100 2.6e-06

AA Sequence

MAPQRRAATKAPEGNGAAERRNRSSTKKDRAPREVQRLWQRPWLRTAGLGAGFVLTALLLWSSLGADDGV      1 - 70
AEVLARRGEVVAGRFIEVPCSEDYDSHRRFEGCTPRKCGRGVTDVVITREEAERIRSVAEKGLSLGGSDG     71 - 140
GASILDLHSGALSVGKHFVNLYRYFGDKIQNIFSEEDFRLYREVRQKVQLTIAEAFGISASSLHLTKPTF    141 - 210
FSRINSTEARTAHDEYWHAHVDKVTYGSFDYTSLLYLSNYLEDFGGGRFMFMEEGANKTVEPRAGRVSFF    211 - 280
TSGSENLHRVEKVHWGTRYAITIAFSCNPDHGIEDPAFP                                   281 - 319
//

Text Mined References (7)

PMID Year Title