Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.94
PubTator Score 4.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Nerve Sheath Neoplasms 5 0.0 0.0
Disease Target Count
Nerve Sheath Tumors 5
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Retinitis pigmentosa 23 27 3.97 2.0
medulloblastoma 720 3.295 1.6

Gene RIF (6)

AA Sequence

MDLKLKDCEFWYSLHGQVPGLLDWDMRNELFLPCTTDQCSLAEQILAKYRVGVMKPPEMPQKRRPSPDGD      1 - 70
GPPCEPNLWMWVDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQKDEGSNCSEDKVVESLPSSSSEQSP     71 - 140
LQKQGIHSPSDFELTEEEAEEPDDNSLQSPEMKCYQSQKLWQINNQEKSWQRPPLNCSHLIALALRNNPH    141 - 210
CGLSVQEIYNFTRQHFPFFWTAPDGWKSTIHYNLCFLDSFEKVPDSLKDEDNARPRSCLWKLTKEGHRRF    211 - 280
WEETRVLAFAQRERIQECMSQPELLTSLFDL                                           281 - 311
//

Text Mined References (10)

PMID Year Title