Property Summary

NCBI Gene PubMed Count 12
PubMed Score 27.36
PubTator Score 34.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
malignant mesothelioma 3163 4.86588600585546E-6
psoriasis 6685 1.10909797835576E-5
atypical teratoid / rhabdoid tumor 4369 6.60515178063396E-5
medulloblastoma, large-cell 6234 1.01075005285964E-4
medulloblastoma 1524 0.00159806082407482
dermatomyositis 967 0.00295604120332675
Gaucher disease type 1 171 0.00330748684378632
ovarian cancer 8492 0.0274194669519497
lung cancer 4473 0.043474213402991
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 1.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 383 0.0 4.0
Disease Target Count Z-score Confidence
Onchocerciasis 8 3.321 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 2.200 0.000
psoriasis -2.500 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma 1.400 0.002
medulloblastoma, large-cell 1.500 0.000
lung cancer -1.100 0.043
ovarian cancer 1.100 0.027
Gaucher disease type 1 -1.600 0.003
dermatomyositis 1.100 0.003

Synonym

Accession Q6PIJ6 Q6PK72 Q7Z2U0 Q86VN3 Q9BXY6 Q9H837 Q9HC40
Symbols MOKA
Fbx38
HMN2D
SP329

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Pathway (1)

Gene RIF (3)

PMID Text
26643602 Our findings provide direct evidence for the association of FBXO38 and AP3B2 with severe chronic periodontitis in the Han Chinese population.
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
14729953 This publication identifies the F-box protein 38 mouse ortholog and characterizes its interaction with KLF7 during regulation of cell cycle progression.

AA Sequence

MGPRKKSVKTCIMNNEIPEEMTADETKDYMNQLSHEVLCHIFRYLPLQDIMCMECLSRKLKEAVTLYLRV      1 - 70
VRVVDLCAGRWWEYMPSGFTDASFLTLLKKMPDVEQLYGLHPRYLERRRVRGHEAFSIPGVLEALQACPN     71 - 140
LVGVETSHLELVESIWTYMPHVHILGKFRNRNGAFPIPPENKLKIPIGAKIQTLHLVGVNVPEIPCIPML    141 - 210
RHLYMKWVRLTKPQPFKDFLCISLRTFVMRNCAGPTNSLKYVPLVTGLASARNLEHLEMVRVPFLGGLIQ    211 - 280
HVVEDSWRSGGFRNLHTIVLGACKNALEVDLGYLIITAARRLHEVRIQPSLTKDGVFSALKMAELEFPQF    281 - 350
ETLHLGYVDEFLLQSRMANADLVKYGLADVVENPGIITDIGMKAVNEVFSCIKYLAIYNCPHLHNPYNWI    351 - 420
SDHSRWTRLVDINLVRCHALKLDSFGQFIELLPSLEFISLDQMFREPPKGCARVGLSAGTGIGVSSALVS    421 - 490
NQNSNNDDNNAQNNNANIHDNNHHHPDDSDEENDFRQDLQPGEQQFAADALNEMEDIVQEDGEVVAESGN    491 - 560
NTPAHSQAIIPVDVDEEQAGPSGLQRVVKPTSITVHDSESDDEEDSLELQEVWIPKNGTRRYSEREEKTG    561 - 630
ESVQSRELSVSGKGKTPLRKRYNSHQMGQSKQFPLEESSCEKGCQVTSEQIKADMKAARDIPEKKKNKDV    631 - 700
YPSCSSTTASTVGNSSSHNTASQSPDFVRTVNSGGSSEPSPTEVDVSRQCACSPGGSEDSEAMEEGDAES    701 - 770
SVCPRCCCHRPQESQRRTSRCSDEERPSTSRACVVNGPDGTRSAFSFRTLPQGGSSGPAHDERTNGSGSG    771 - 840
ATGEDRRGSSQPESCDVQSNEDYPRRPLTRARSRLSHVLLVSESEVAKTKPRHAMKRKRTADKSTSTSDP    841 - 910
VIEDDHVQVLVLKSKNLVGVTMTNCGITDLVLKDCPKMMFIHATRCRVLKHLKVENAPIVNRFDYAQCKK    911 - 980
LNMDQVLDQILRMPPERNRIIYLRPMQQVDTLTLEQKLFSGPYPYHICIIHEFSNPPNVRNKVRIRSWMD    981 - 1050
TIANINQELIKYEFFPEATRSEEDLKKYPKYPWGREIYTLEGVVDGAPYSMISDFPWLRSLRAAEPNSFA   1051 - 1120
RYDFEDDEESTIYAPRRKGQLSADICMETIGEEISEMRQMKKGVFQRVVAIFIHYCDVNGEPVEDDYI     1121 - 1188
//

Text Mined References (16)

PMID Year Title
26643602 2015 Two-stage comprehensive evaluation of genetic susceptibility of common variants in FBXO38, AP3B2 and WHAMM to severe chronic periodontitis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24207122 2013 A dominant mutation in FBXO38 causes distal spinal muscular atrophy with calf predominance.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
More...