Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 0.000
adult high grade glioma -1.100 0.000
group 4 medulloblastoma -1.500 0.000
non primary Sjogren syndrome sicca 1.300 0.017
Breast cancer 1.100 0.000

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLR      1 - 70
PGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAG     71 - 140
CGSCLEGSAQQMYQSLAELGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKARPLSRRGKR    141 - 210
VGGEGTGFGVGGALRQGLMVTGACGHSRRGMRMTCPLCRRLWARSASTTPSCGWREYGCCPGASTVTWTL    211 - 280
RKASGDCVLG                                                                281 - 290
//

Text Mined References (8)

PMID Year Title
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.