Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 2.03630434848795E-14
atypical teratoid / rhabdoid tumor 4369 3.67797465692975E-10
group 4 medulloblastoma 1875 5.33758513129546E-6
adult high grade glioma 2148 2.63776017095165E-4
non primary Sjogren syndrome sicca 840 0.016863372538264

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 0.000
adult high grade glioma -1.100 0.000
group 4 medulloblastoma -1.500 0.000
non primary Sjogren syndrome sicca 1.300 0.017
Breast cancer 1.100 0.000

Synonym

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLR      1 - 70
PGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAG     71 - 140
CGSCLEGSAQQMYQSLAELGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKARPLSRRGKR    141 - 210
VGGEGTGFGVGGALRQGLMVTGACGHSRRGMRMTCPLCRRLWARSASTTPSCGWREYGCCPGASTVTWTL    211 - 280
RKASGDCVLG                                                                281 - 290
//

Text Mined References (8)

PMID Year Title
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.