Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
Funding $203,850
PubMed Score 6.50
PubTator Score 3.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -3.100 0.000
astrocytic glioma -1.600 0.010
ependymoma -2.100 0.009
psoriasis -1.700 0.000
medulloblastoma, large-cell -1.600 0.003
interstitial cystitis -1.200 0.000
adult high grade glioma -1.200 0.000
lung carcinoma 1.100 0.000

Synonym

Accession Q6PI77 Q9C0G2 bHLHb9
Symbols GASP3
p60TRP

Gene

 Grant Application (1)

Gene RIF (2)

PMID Text
26854063 Report that some regions of p60TRP were more prone to specific mutations, with two hotspots for mutations at E15 and E171.
15034937 Down-regulation in the brain of Alzheimer's disease subjects point to a possible pivotal role of p60TRP in the control of cellular aging and survival.

AA Sequence

MAGTKNKTRAQAKTEKKAAIQAKAGAEREATGVVRPVAKTRAKAKAKTGSKTDAVAEMKAVSKNKVVAET      1 - 70
KEGALSEPKTLGKAMGDFTPKAGNESTSSTCKNEAGTDAWFWAGEEATINSWFWNGEEAGNSFSTKNDKP     71 - 140
EIGAQVCAEELEPAAGADCKPRSGAEEEEEENVIGNWFWEGDDTSFDPNPKPVSRIVKPQPVYEINEKNR    141 - 210
PKDWSEVTIWPNAPAVTPAVLGFRSQAPSEASPPSYIVLASAEENACSLPVATACRPSRNTRSCSQPIPE    211 - 280
CRFDSDPCIQTIDEIRRQIRIREVNGIKPFACPCKMECYMDSEEFEKLVSLLKSTTDPLIHKIARIAMGV    281 - 350
HNVHPFAQEFINEVGVVTLIESLLSFPSPEMRKKTVITLNPPSGDERQRKIELHVKHMCKETMSFPLNSP    351 - 420
GQQSGLKILGQLTTDFVHHYIVANYFSELFHLLSSGNCKTRNLVLKLLLNMSENPTAARDMINMKALAAL    421 - 490
KLIFNQKEAKANLVSGVAIFINIKEHIRKGSIVVVDHLSYNTLMAIFREVKEIIETM                 491 - 547
//

Text Mined References (12)

PMID Year Title
26854063 2016 Glutamate E15 and E171 are Hotspots in p60TRP-Related Cancer.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18089774 2007 Discovery of epigenetically silenced genes by methylated DNA immunoprecipitation in colon cancer cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15034937 2004 Characterizing the new transcription regulator protein p60TRP.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
More...