Property Summary

NCBI Gene PubMed Count 13
PubMed Score 19.14
PubTator Score 20.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 1.3e-17
osteosarcoma 7950 1.1e-06

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.200 1.3e-17
osteosarcoma 1.269 1.1e-06

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVP      1 - 70
EYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLA     71 - 140
FYLLSFFYYLYSMVYTLVSF                                                      141 - 160
//

Text Mined References (13)

PMID Year Title