Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
R01 Count 4
Funding $491,344.17
PubMed Score 18.11
PubTator Score 20.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Disease Z-score Confidence
Gout 93
lung carcinoma 2,844
osteosarcoma 7,933

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.269 0.000
lung carcinoma 1.200 0.000

Gene RIF (1)

PMID Text
23103966 Significant upregulation of CNIH-2 mRNA expression was found in schizophrenia.

AA Sequence

MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVP      1 - 70
EYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLA     71 - 140
FYLLSFFYYLYSMVYTLVSF                                                      141 - 160
//

Text Mined References (13)

PMID Year Title
24853943 2014 Cornichon2 dictates the time course of excitatory transmission at individual hippocampal synapses.
23103966 2012 Upregulation of cornichon transcripts in the dorsolateral prefrontal cortex in schizophrenia.
22815494 2012 Cornichons modify channel properties of recombinant and glial AMPA receptors.
22211840 2012 AMPA receptor modulation by cornichon-2 dictated by transmembrane AMPA receptor regulatory protein isoform.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21543622 2011 Cornichon-2 modulates AMPA receptor-transmembrane AMPA receptor regulatory protein assembly to dictate gating and pharmacology.
21343286 2011 Transmembrane AMPA receptor regulatory proteins and cornichon-2 allosterically regulate AMPA receptor antagonists and potentiators.
21172611 2010 Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins.
20805473 2010 Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating.
17229890 2007 Cornichon-like protein facilitates secretion of HB-EGF and regulates proper development of cranial nerves.
More...