Property Summary

NCBI Gene PubMed Count 16
PubMed Score 48.25
PubTator Score 54.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.600 2.5e-04
Astrocytoma, Pilocytic -1.100 4.3e-04
atypical teratoid / rhabdoid tumor -1.100 2.4e-07
ependymoma -1.300 5.1e-07
glioblastoma -1.300 1.6e-05
group 4 medulloblastoma -1.400 9.7e-04
intraductal papillary-mucinous adenoma (... 1.100 1.7e-04
intraductal papillary-mucinous neoplasm ... 1.300 7.0e-04
lung carcinoma 1.500 4.2e-35
medulloblastoma, large-cell -1.800 1.2e-05
osteosarcoma -1.233 5.8e-05
primitive neuroectodermal tumor -1.400 1.1e-03
psoriasis -1.300 5.1e-04
subependymal giant cell astrocytoma -1.251 2.5e-02

Gene RIF (4)

AA Sequence

MWSLTASEGESTTAHFFLGAGDEGLGTRGIGMRPEESDSELLEDEEDEVPPEPQIIVGICAMTKKSKSKP      1 - 70
MTQILERLCRFDYLTVVILGEDVILNEPVENWPSCHCLISFHSKGFPLDKAVAYSKLRNPFLINDLAMQY     71 - 140
YIQDRREVYRILQEEGIDLPRYAVLNRDPARPEECNLIEGEDQVEVNGAVFPKPFVEKPVSAEDHNVYIY    141 - 210
YPSSAGGGSQRLFRKIGSRSSVYSPESSVRKTGSYIYEEFMPTDGTDVKVYTVGPDYAHAEARKSPALDG    211 - 280
KVERDSEGKEIRYPVMLTAMEKLVARKVCVAFKQTVCGFDLLRANGHSFVCDVNGFSFVKNSMKYYDDCA    281 - 350
KILGNTIMRELAPQFQIPWSIPTEAEDIPIVPTTSGTMMELRCVIAIIRHGDRTPKQKMKMEVKHPRFFA    351 - 420
LFEKHGGYKTGKLKLKRPEQLQEVLDITRLLLAELEKEPGGEIEEKTGKLEQLKSVLEMYGHFSGINRKV    421 - 490
QLTYYPHGVKASNEGQDPQRETLAPSLLLVLKWGGELTPAGRVQAEELGRAFRCMYPGGQGDYAGFPGCG    491 - 560
LLRLHSTFRHDLKIYASDEGRVQMTAAAFAKGLLALEGELTPILVQMVKSANMNGLLDSDGDSLSSCQHR    561 - 630
VKARLHHILQQDAPFGPEDYDQLAPTRSTSLLNSMTIIQNPVKVCDQVFALIENLTHQIRERMQDPRSVD    631 - 700
LQLYHSETLELMLQRWSKLERDFRQKSGRYDISKIPDIYDCVKYDVQHNGSLGLQGTAELLRLSKALADV    701 - 770
VIPQEYGISREEKLEIAVGFCLPLLRKILLDLQRTHEDESVNKLHPLCYLRYSRGVLSPGRHVRTRLYFT    771 - 840
SESHVHSLLSVFRYGGLLDETQDAQWQRALDYLSAISELNYMTQIVIMLYEDNTQDPLSEERFHVELHFS    841 - 910
PGVKGVEEEGSAPAGCGFRPASSENEEMKTNQGSMENLCPGKASDEPDRALQTSPQPPEGPGLPRRSPLI    911 - 980
RNRKAGSMEVLSETSSSRPGGYRLFSSSRPPTEMKQSGLGSQCTGLFSTTVLGGSSSAPNLQDYARSHGK    981 - 1050
KLPPASLKHRDELLFVPAVKRFSVSFAKHPTNGFEGCSMVPTIYPLETLHNALSLRQVSEFLSRVCQRHT   1051 - 1120
DAQAQASAALFDSMHSSQASDNPFSPPRTLHSPPLQLQQRSEKPPWYSSGPSSTVSSAGPSSPTTVDGNS   1121 - 1190
QFGFSDQPSLNSHVAEEHQGLGLLQETPGSGAQELSIEGEQELFEPNQSPQVPPMETSQPYEEVSQPCQE   1191 - 1260
VPDISQPCQDISEALSQPCQKVPDISQQCQENHDNGNHTCQEVPHISQPCQKSSQLCQKVSEEVCQLCLE   1261 - 1330
NSEEVSQPCQGVSVEVGKLVHKFHVGVGSLVQETLVEVGSPAEEIPEEVIQPYQEFSVEVGRLAQETSAI   1331 - 1400
NLLSQGIPEIDKPSQEFPEEIDLQAQEVPEEIN                                        1401 - 1433
//

Text Mined References (24)

PMID Year Title