Property Summary

NCBI Gene PubMed Count 13
PubMed Score 44.87
PubTator Score 54.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 4.20488474845385E-35
atypical teratoid / rhabdoid tumor 4369 1.36225461438035E-9
osteosarcoma 7933 4.56744316153038E-9
ependymoma 2514 5.10420186498825E-7
medulloblastoma, large-cell 6234 1.17634478284619E-5
glioblastoma 5572 1.59656200415553E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.70482986646717E-4
adult high grade glioma 2148 2.49922623257712E-4
medulloblastoma 1524 3.51265707928107E-4
pilocytic astrocytoma 3086 4.03972184501695E-4
psoriasis 6685 5.0786285020178E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.99101665178076E-4
primitive neuroectodermal tumor 3031 0.00109915263323108
subependymal giant cell astrocytoma 2287 0.0254327438501861
Disease Target Count Z-score Confidence
MHC class II deficiency 2 3.372 1.7

Expression

  Differential Expression (14)

Synonym

Accession Q6PFW1 O15082 Q5HYF8 Q7Z3A7 Q86TE7 Q86UV3 Q86UV4 Q86XW8 Q8IZN0
Symbols IP6K
IPS1
VIP1
hsVIP1
HISPPD2A

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (1)

PMID Text
21222653 Upon activation of the appropriate cell-surface receptors to stimulate PtdIns(3,4,5)P3 synthesis, human PPIP5K1 translocates from the cytoplasm to the plasma membrane.

AA Sequence

MWSLTASEGESTTAHFFLGAGDEGLGTRGIGMRPEESDSELLEDEEDEVPPEPQIIVGICAMTKKSKSKP      1 - 70
MTQILERLCRFDYLTVVILGEDVILNEPVENWPSCHCLISFHSKGFPLDKAVAYSKLRNPFLINDLAMQY     71 - 140
YIQDRREVYRILQEEGIDLPRYAVLNRDPARPEECNLIEGEDQVEVNGAVFPKPFVEKPVSAEDHNVYIY    141 - 210
YPSSAGGGSQRLFRKIGSRSSVYSPESSVRKTGSYIYEEFMPTDGTDVKVYTVGPDYAHAEARKSPALDG    211 - 280
KVERDSEGKEIRYPVMLTAMEKLVARKVCVAFKQTVCGFDLLRANGHSFVCDVNGFSFVKNSMKYYDDCA    281 - 350
KILGNTIMRELAPQFQIPWSIPTEAEDIPIVPTTSGTMMELRCVIAIIRHGDRTPKQKMKMEVKHPRFFA    351 - 420
LFEKHGGYKTGKLKLKRPEQLQEVLDITRLLLAELEKEPGGEIEEKTGKLEQLKSVLEMYGHFSGINRKV    421 - 490
QLTYYPHGVKASNEGQDPQRETLAPSLLLVLKWGGELTPAGRVQAEELGRAFRCMYPGGQGDYAGFPGCG    491 - 560
LLRLHSTFRHDLKIYASDEGRVQMTAAAFAKGLLALEGELTPILVQMVKSANMNGLLDSDGDSLSSCQHR    561 - 630
VKARLHHILQQDAPFGPEDYDQLAPTRSTSLLNSMTIIQNPVKVCDQVFALIENLTHQIRERMQDPRSVD    631 - 700
LQLYHSETLELMLQRWSKLERDFRQKSGRYDISKIPDIYDCVKYDVQHNGSLGLQGTAELLRLSKALADV    701 - 770
VIPQEYGISREEKLEIAVGFCLPLLRKILLDLQRTHEDESVNKLHPLCYLRYSRGVLSPGRHVRTRLYFT    771 - 840
SESHVHSLLSVFRYGGLLDETQDAQWQRALDYLSAISELNYMTQIVIMLYEDNTQDPLSEERFHVELHFS    841 - 910
PGVKGVEEEGSAPAGCGFRPASSENEEMKTNQGSMENLCPGKASDEPDRALQTSPQPPEGPGLPRRSPLI    911 - 980
RNRKAGSMEVLSETSSSRPGGYRLFSSSRPPTEMKQSGLGSQCTGLFSTTVLGGSSSAPNLQDYARSHGK    981 - 1050
KLPPASLKHRDELLFVPAVKRFSVSFAKHPTNGFEGCSMVPTIYPLETLHNALSLRQVSEFLSRVCQRHT   1051 - 1120
DAQAQASAALFDSMHSSQASDNPFSPPRTLHSPPLQLQQRSEKPPWYSSGPSSTVSSAGPSSPTTVDGNS   1121 - 1190
QFGFSDQPSLNSHVAEEHQGLGLLQETPGSGAQELSIEGEQELFEPNQSPQVPPMETSQPYEEVSQPCQE   1191 - 1260
VPDISQPCQDISEALSQPCQKVPDISQQCQENHDNGNHTCQEVPHISQPCQKSSQLCQKVSEEVCQLCLE   1261 - 1330
NSEEVSQPCQGVSVEVGKLVHKFHVGVGSLVQETLVEVGSPAEEIPEEVIQPYQEFSVEVGRLAQETSAI   1331 - 1400
NLLSQGIPEIDKPSQEFPEEIDLQAQEVPEEIN                                        1401 - 1433
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23300138 2014 A genome wide association study of genetic loci that influence tumour biomarkers cancer antigen 19-9, carcinoembryonic antigen and ? fetoprotein and their associations with cancer risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21222653 2011 Receptor-dependent compartmentalization of PPIP5K1, a kinase with a cryptic polyphosphoinositide binding domain.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18981179 2009 Structural analysis and detection of biological inositol pyrophosphates reveal that the family of VIP/diphosphoinositol pentakisphosphate kinases are 1/3-kinases.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...