Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6PCB6 Q1RMD6 Q9NPM1
Symbols FAM108C1

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MPEPGPRMNGFSLGELCWLFCCPPCPSRIAAKLAFLPPEPTYTVLAPEQRGAGASAPAPAQATAAAAAAQ      1 - 70
PAPQQPEEGAGAGPGACSLHLSERADWQYSQRELDAVEVFFSRTARDNRLGCMFVRCAPSSRYTLLFSHG     71 - 140
NAVDLGQMCSFYIGLGSRINCNIFSYDYSGYGVSSGKPSEKNLYADIDAAWQALRTRYGVSPENIILYGQ    141 - 210
SIGTVPTVDLASRYECAAVILHSPLMSGLRVAFPDTRKTYCFDAFPSIDKISKVTSPVLVIHGTEDEVID    211 - 280
FSHGLAMYERCPRAVEPLWVEGAGHNDIELYAQYLERLKQFISHELPNS                         281 - 329
//

Text Mined References (4)

PMID Year Title
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.