Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ductal carcinoma in situ 1.800 1.5e-03
intraductal papillary-mucinous adenoma (... 2.900 3.8e-05
intraductal papillary-mucinous carcinoma... 2.900 1.0e-04
intraductal papillary-mucinous neoplasm ... 3.500 5.3e-04
invasive ductal carcinoma 2.000 2.7e-03
medulloblastoma, large-cell -1.100 3.6e-04
osteosarcoma 1.175 6.7e-03
ovarian cancer 1.300 3.9e-04
pancreatic cancer 2.300 2.3e-08
psoriasis 1.300 5.2e-119
spina bifida -2.235 4.0e-02
tuberculosis -2.200 3.7e-05

Synonym

Accession Q6PCB6 Q1RMD6 Q9NPM1
Symbols FAM108C1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MPEPGPRMNGFSLGELCWLFCCPPCPSRIAAKLAFLPPEPTYTVLAPEQRGAGASAPAPAQATAAAAAAQ      1 - 70
PAPQQPEEGAGAGPGACSLHLSERADWQYSQRELDAVEVFFSRTARDNRLGCMFVRCAPSSRYTLLFSHG     71 - 140
NAVDLGQMCSFYIGLGSRINCNIFSYDYSGYGVSSGKPSEKNLYADIDAAWQALRTRYGVSPENIILYGQ    141 - 210
SIGTVPTVDLASRYECAAVILHSPLMSGLRVAFPDTRKTYCFDAFPSIDKISKVTSPVLVIHGTEDEVID    211 - 280
FSHGLAMYERCPRAVEPLWVEGAGHNDIELYAQYLERLKQFISHELPNS                         281 - 329
//

Text Mined References (5)

PMID Year Title