Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
cystic fibrosis and chronic rhinosinusit... 1.094 2.2e-02
gastric cancer 1.200 3.1e-03
group 3 medulloblastoma 1.200 1.9e-04
hepatocellular carcinoma 1.300 2.7e-05
osteosarcoma -1.327 1.2e-04
ovarian cancer -1.100 1.3e-04
pancreatic cancer 1.100 1.3e-02
pancreatic carcinoma 1.100 1.3e-02
Pick disease 1.200 1.7e-03
subependymal giant cell astrocytoma -1.168 4.0e-02
tuberculosis and treatment for 6 months -1.400 7.5e-03

Gene RIF (1)

AA Sequence

MAEPPSPVHCVAAAAPTATVSEKEPFGKLQLSSRDPPGSLSAKKVRTEEKKAPRRVNGEGGSGGNSRQLQ      1 - 70
PPAAPSPQSYGSPASWSFAPLSAAPSPSSSRSSFSFSAGTAVPSSASASLSQPVPRKLLVPPTLLHAQPH     71 - 140
HLLLPAAAAAASANAKSRRPKEKREKERRRHGLGGAREAGGASREENGEVKPLPRDKIKDKIKERDKEKE    141 - 210
REKKKHKVMNEIKKENGEVKILLKSGKEKPKTNIEDLQIKKVKKKKKKKHKENEKRKRPKMYSKSIQTIC    211 - 280
SGLLTDVEDQAAKGILNDNIKDYVGKNLDTKNYDSKIPENSEFPFVSLKEPRVQNNLKRLDTLEFKQLIH    281 - 350
IEHQPNGGASVIHAYSNELSHLSPMEMERFAEEFVGLVFSENENSAAFYVMGIVHGAATYLPDFLDYFSF    351 - 420
NFPNSPVKMEILGKKDIETTTMSNFHAQVKRTYSHGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEES    421 - 490
PFLKCTLPWGTLSSLKLQSRKDSDDGPIMWVRPGEQMIPVADMPKSPFKRKRTTNEIKNLQYLPRTSEPR    491 - 560
EMLFEDRTRAHADHIGQGFERQTTAAVGVLKAVHCGEWPDQPRITKDVICFHAEDFLEVVQRMQLDLHEP    561 - 630
PLSQCVQWVDDAKLNQLRREGIRYARIQLYDNDIYFIPRNVVHQFKTVSAVCSLAWHIRLKLYHSEEDTS    631 - 700
QNTATHETGTSSDSTSSVLGPHTDNMICAVSKASLDSVFSDKLHSKYELQQIKHEPIASVRIKEEPVNVN    701 - 770
IPEKTTALNNMDGKNVKAKLDHVQFAEFKIDMDSKFENSNKDLKEELCPGNLSLVDTRQHSSAHSNQDKK    771 - 840
DDDILC                                                                    841 - 846
//

Text Mined References (19)

PMID Year Title