Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $177,419.25
PubMed Score 0.17
PubTator Score 8.23

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
23357503 Cox regression and Kaplan-Meier survival analysis identified that amplification of the CNKSR3 gene (log-rank, P = 0.022) with an associated increase in its protein expression (log-rank, P = 0.011) correlated with longer patient survival.
22851176 CNK3 is a molecular scaffold, which coordinates the assembly of a multiprotein ENaC-regulatory complex and hence plays a central role in Na(+) homeostasis.
22457146 two gene markers (CNKSR3 and SPTBN2) differentiate between aspirin-exacerbated respiratory disease and aspirin-tolerant asthma with a perfect discriminative power
22085542 CNK3 and IPCEF1 produce a single protein that is required for HGF dependent Arf6 activation and migration.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19567370 CNKSR3, a homologue of scaffold proteins involved in MAPK pathway regulation, is a direct target of MR and is required for the maintenance of transepithelial sodium transport in the kidney.

AA Sequence

MEPVTKWSPKQVVDWTRGLDDCLQQYVHKFEREKINGEQLLQISHQDLEELGVTRIGHQELVLEAVDLLC      1 - 70
ALNYGLETDNMKNLVLKLRASSHNLQNYISSRRKSPAYDGNTSRKAPNEFLTSVVELIGAAKALLAWLDR     71 - 140
APFTGITDFSVTKNKIIQLCLDLTTTVQKDCFVAEMEDKVLTVVKVLNGICDKTIRSTTDPVMSQCACLE    141 - 210
EVHLPNIKPGEGLGMYIKSTYDGLHVITGTTENSPADRSQKIHAGDEVIQVNQQTVVGWQLKNLVKKLRE    211 - 280
NPTGVVLLLKKRPTGSFNFTPAPLKNLRWKPPLVQTSPPPATTQSPESTMDTSLKKEKSAILDLYIPPPP    281 - 350
AVPYSPRDENGSFVYGGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMR    351 - 420
EKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRYFSNERIPPIIEESSSPPYRFSRPTTE    421 - 490
RHLVRGADYIRGSRCYINSDLHSSATIPFQEEGTKKKSGSSATKSSSTEPSLLVSWFTRLKLLTH         491 - 555
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23357503 2013 Single nucleotide polymorphism array analysis of uveal melanomas reveals that amplification of CNKSR3 is correlated with improved patient survival.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22851176 2012 Scaffold protein connector enhancer of kinase suppressor of Ras isoform 3 (CNK3) coordinates assembly of a multiprotein epithelial sodium channel (ENaC)-regulatory complex.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
22457146 2012 Differential gene expression profile in PBMCs from subjects with AERD and ATA: a gene marker for AERD.
22451204 2012 Meta-analysis of Parkinson's disease: identification of a novel locus, RIT2.
22085542 2012 CNK3 and IPCEF1 produce a single protein that is required for HGF dependent Arf6 activation and migration.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19567370 2009 Cnksr3 is a direct mineralocorticoid receptor target gene and plays a key role in the regulation of the epithelial sodium channel.
More...