Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.03
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung carcinoma 413 1.38143315517088E-24
lung adenocarcinoma 2714 3.45309278058449E-13
ovarian cancer 8492 1.03096260131444E-8
group 4 medulloblastoma 1875 2.0920357706618E-6
pilocytic astrocytoma 3086 4.19009500904337E-6
posterior fossa group B ependymoma 1530 1.0612278274037E-5
facioscapulohumeral dystrophy 286 1.97469384822204E-5
adult high grade glioma 2148 2.56474426290981E-5
Breast cancer 3099 4.98397132122164E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.62017260398298E-4
primitive neuroectodermal tumor 3031 2.64238717688545E-4
atypical teratoid / rhabdoid tumor 4369 0.0020763663341843
astrocytic glioma 2241 0.00443766640497939
adrenocortical carcinoma 1427 0.00514661451310124
glioblastoma 5572 0.00852054301949895
active Crohn's disease 918 0.015563334250685
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 2.0
Type 2 diabetes mellitus 192 0.0 1.0

Expression

Synonym

Accession Q6P9A2 O95903 Q8NDY9
Symbols GALNT15
GALNTL4
GALNACT18
GalNAc-T15
GalNAc-T18

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 4 (GALNTL4) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVYVRGQEPAPDKKLEEDKGDTLKIIERLDHLE      1 - 70
NVIKQHIQEAPAKPEEAEAEPFTDSSLFAHWGQELSPEGRRVALKQFQYYGYNAYLSDRLPLDRPLPDLR     71 - 140
PSGCRNLSFPDSLPEVSIVFIFVNEALSVLLRSIHSAMERTPPHLLKEIILVDDNSSNEELKEKLTEYVD    141 - 210
KVNSQKPGFIKVVRHSKQEGLIRSRVSGWRAATAPVVALFDAHVEFNVGWAEPVLTRIKENRKRIISPSF    211 - 280
DNIKYDNFEIEEYPLAAQGFDWELWCRYLNPPKAWWKLENSTAPIRSPALIGCFIVDRQYFQEIGLLDEG    281 - 350
MEVYGGENVELGIRVWQCGGSVEVLPCSRIAHIERAHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVYMA    351 - 420
WNIPQEDSGIDIGDITARKALRKQLQCKTFRWYLVSVYPEMRMYSDIIAYGVLQNSLKTDLCLDQGPDTE    421 - 490
NVPIMYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRPRLIECSYAKAKRMKLHWQFSQG    491 - 560
GPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITNVLRSLAS                           561 - 607
//

Text Mined References (12)

PMID Year Title
22491018 2013 Genome-wide association analysis implicates the involvement of eight loci with response to tocilizumab for the treatment of rheumatoid arthritis.
22238593 2012 A genome-wide association search for type 2 diabetes genes in African Americans.
22186971 2012 UDP-N-acetyl-?-D-galactosamine:polypeptide N-acetylgalactosaminyltransferases: completion of the family tree.
22171061 2012 Characterization of ppGalNAc-T18, a member of the vertebrate-specific Y subfamily of UDP-N-acetyl-?-D-galactosamine:polypeptide N-acetylgalactosaminyltransferases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...