Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.03
PubTator Score 1.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6P9A2 O95903 Q8NDY9
Symbols GALNT15
GALNTL4
GALNACT18
GalNAc-T15
GalNAc-T18

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 4 (GALNTL4) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVYVRGQEPAPDKKLEEDKGDTLKIIERLDHLE      1 - 70
NVIKQHIQEAPAKPEEAEAEPFTDSSLFAHWGQELSPEGRRVALKQFQYYGYNAYLSDRLPLDRPLPDLR     71 - 140
PSGCRNLSFPDSLPEVSIVFIFVNEALSVLLRSIHSAMERTPPHLLKEIILVDDNSSNEELKEKLTEYVD    141 - 210
KVNSQKPGFIKVVRHSKQEGLIRSRVSGWRAATAPVVALFDAHVEFNVGWAEPVLTRIKENRKRIISPSF    211 - 280
DNIKYDNFEIEEYPLAAQGFDWELWCRYLNPPKAWWKLENSTAPIRSPALIGCFIVDRQYFQEIGLLDEG    281 - 350
MEVYGGENVELGIRVWQCGGSVEVLPCSRIAHIERAHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVYMA    351 - 420
WNIPQEDSGIDIGDITARKALRKQLQCKTFRWYLVSVYPEMRMYSDIIAYGVLQNSLKTDLCLDQGPDTE    421 - 490
NVPIMYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRPRLIECSYAKAKRMKLHWQFSQG    491 - 560
GPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITNVLRSLAS                           561 - 607
//

Text Mined References (12)

PMID Year Title
22491018 2013 Genome-wide association analysis implicates the involvement of eight loci with response to tocilizumab for the treatment of rheumatoid arthritis.
22238593 2012 A genome-wide association search for type 2 diabetes genes in African Americans.
22186971 2012 UDP-N-acetyl-?-D-galactosamine:polypeptide N-acetylgalactosaminyltransferases: completion of the family tree.
22171061 2012 Characterization of ppGalNAc-T18, a member of the vertebrate-specific Y subfamily of UDP-N-acetyl-?-D-galactosamine:polypeptide N-acetylgalactosaminyltransferases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...