Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.29
PubTator Score 1.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.008 1.6e-02
adrenocortical carcinoma 1.277 5.1e-03
adult high grade glioma -1.600 2.6e-05
astrocytic glioma -1.100 4.4e-03
Astrocytoma, Pilocytic -1.500 5.0e-06
atypical teratoid / rhabdoid tumor -1.100 2.1e-03
Breast cancer 1.200 5.0e-05
facioscapulohumeral dystrophy -1.800 2.0e-05
glioblastoma -1.100 8.5e-03
group 4 medulloblastoma -2.000 2.1e-06
intraductal papillary-mucinous adenoma (... -1.100 1.6e-04
lung adenocarcinoma -1.200 6.1e-14
non-small cell lung cancer -1.098 2.4e-10
ovarian cancer -2.100 1.0e-08
posterior fossa group A ependymoma -1.100 2.5e-07
primitive neuroectodermal tumor -1.600 2.6e-04

Gene RIF (4)

AA Sequence

MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVYVRGQEPAPDKKLEEDKGDTLKIIERLDHLE      1 - 70
NVIKQHIQEAPAKPEEAEAEPFTDSSLFAHWGQELSPEGRRVALKQFQYYGYNAYLSDRLPLDRPLPDLR     71 - 140
PSGCRNLSFPDSLPEVSIVFIFVNEALSVLLRSIHSAMERTPPHLLKEIILVDDNSSNEELKEKLTEYVD    141 - 210
KVNSQKPGFIKVVRHSKQEGLIRSRVSGWRAATAPVVALFDAHVEFNVGWAEPVLTRIKENRKRIISPSF    211 - 280
DNIKYDNFEIEEYPLAAQGFDWELWCRYLNPPKAWWKLENSTAPIRSPALIGCFIVDRQYFQEIGLLDEG    281 - 350
MEVYGGENVELGIRVWQCGGSVEVLPCSRIAHIERAHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVYMA    351 - 420
WNIPQEDSGIDIGDITARKALRKQLQCKTFRWYLVSVYPEMRMYSDIIAYGVLQNSLKTDLCLDQGPDTE    421 - 490
NVPIMYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRPRLIECSYAKAKRMKLHWQFSQG    491 - 560
GPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITNVLRSLAS                           561 - 607
//

Text Mined References (12)

PMID Year Title