Property Summary

NCBI Gene PubMed Count 13
PubMed Score 11.39
PubTator Score 4.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung cancer 2890 1.0e-15
osteosarcoma 7950 8.4e-10
ovarian cancer 8520 1.4e-08
group 3 medulloblastoma 4104 9.6e-03
spina bifida 1074 3.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
SPOAN syndrome 2 6.365 3.2

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma -1.100 9.6e-03
non-small cell lung cancer 1.685 1.0e-15
osteosarcoma 3.279 8.4e-10
ovarian cancer 1.300 1.4e-08
spina bifida -1.777 3.7e-02

Gene RIF (6)

AA Sequence

MSVQVAAPGSAGLGPERLSPEELVRQTRQVVQGLEALRAEHHGLAGHLAEALAGQGPAAGLEMLEEKQQV      1 - 70
VSHSLEAIELGLGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLREELEETQRRLRASEESVAQL     71 - 140
EEEKRHLEFLGQLRQYDPPAESQQSESPPRRDSLASLFPSEEEERKGPEAAGAAAAQQGGYEIPARLRTL    141 - 210
HNLVIQYAGQGRYEVAVPLCRQALEDLERSSGHCHPDVATMLNILALVYRDQNKYKEATDLLHDALQIRE    211 - 280
QTLGPEHPAVAATLNNLAVLYGKRGRYREAEPLCQRALEIREKVLGADHPDVAKQLNNLALLCQNQGKFE    281 - 350
DVERHYARALSIYEALGGPHDPNVAKTKNNLASAYLKQNKYQQAEELYKEILHKEDLPAPLGAPNTGTAG    351 - 420
DAEQALRRSSSLSKIRESIRRGSEKLVSRLRGEAAAGAAGMKRAMSLNTLNVDAPRAPGTQFPSWHLDKA    421 - 490
PRTLSASTQDLSPH                                                            491 - 504
//

Text Mined References (18)

PMID Year Title