Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.12
PubTator Score 4.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 3.279 0.000
non-small cell lung cancer 1.685 0.000
group 3 medulloblastoma -1.100 0.010
spina bifida -1.777 0.037
ovarian cancer 1.300 0.000

Synonym

Accession Q6P597 A0AVM3 A2RUT6 Q6GMU2 Q8NAL1 Q8WWJ9
Symbols KLC2
KLCt
KLC2L
KNS2B

Gene

Gene RIF (6)

PMID Text
25209998 Microtubule-bound kinesin-1 and kinesin-3 motor domains were visualized at multiple steps in their ATPase cycles--including their nucleotide-free states--at approximately 7 A resolution using cryo-electron microscopy.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15464570 Rat KHC3 associates with mitochondria in sperm tails
12594206 Rat KLC3 associates with the outer dense fibers of maturing sperm tails.
11319135 Rat KLC3 interacts with KHC and microtubules in vitro. Expressed in spleen, intestine, brain, ovary, testis. Testis expression restricted to post-meiotic spermatids.

AA Sequence

MSVQVAAPGSAGLGPERLSPEELVRQTRQVVQGLEALRAEHHGLAGHLAEALAGQGPAAGLEMLEEKQQV      1 - 70
VSHSLEAIELGLGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLREELEETQRRLRASEESVAQL     71 - 140
EEEKRHLEFLGQLRQYDPPAESQQSESPPRRDSLASLFPSEEEERKGPEAAGAAAAQQGGYEIPARLRTL    141 - 210
HNLVIQYAGQGRYEVAVPLCRQALEDLERSSGHCHPDVATMLNILALVYRDQNKYKEATDLLHDALQIRE    211 - 280
QTLGPEHPAVAATLNNLAVLYGKRGRYREAEPLCQRALEIREKVLGADHPDVAKQLNNLALLCQNQGKFE    281 - 350
DVERHYARALSIYEALGGPHDPNVAKTKNNLASAYLKQNKYQQAEELYKEILHKEDLPAPLGAPNTGTAG    351 - 420
DAEQALRRSSSLSKIRESIRRGSEKLVSRLRGEAAAGAAGMKRAMSLNTLNVDAPRAPGTQFPSWHLDKA    421 - 490
PRTLSASTQDLSPH                                                            491 - 504
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25209998 2014 Conserved mechanisms of microtubule-stimulated ADP release, ATP binding, and force generation in transport kinesins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23108145 2013 Genome-wide association study reveals novel genetic determinants of DNA repair capacity in lung cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...