Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.10
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 18 1 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 3.3e-07
tuberculosis 2010 1.7e-05
medulloblastoma, large-cell 6241 5.5e-03
osteosarcoma 7950 9.4e-03
aldosterone-producing adenoma 665 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
aldosterone-producing adenoma -1.008 1.6e-02
medulloblastoma, large-cell 1.100 5.5e-03
osteosarcoma -1.222 9.4e-03
ovarian cancer 2.700 3.3e-07
tuberculosis 1.300 1.7e-05

Gene RIF (5)

AA Sequence

MSLEQEEETQPGRLLGRRDAVPAFIEPNVRFWITERQSFIRRFLQWTELLDPTNVFISVESIENSRQLLC      1 - 70
TNEDVSSPASADQRIQEAWKRSLATVHPDSSNLIPKLFRPAAFLPFMAPTVFLSMTPLKGIKSVILPQVF     71 - 140
LCAYMAAFNSINGNRSYTCKPLERSLLMAGAVASSTFLGVIPQFVQMKYGLTGPWIKRLLPVIFLVQASG    141 - 210
MNVYMSRSLESIKGIAVMDKEGNVLGHSRIAGTKAVRETLASRIVLFGTSALIPEVFTYFFKRTQYFRKN    211 - 280
PGSLWILKLSCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV                 281 - 337
//

Text Mined References (17)

PMID Year Title