Property Summary

NCBI Gene PubMed Count 7
Grant Count 6
R01 Count 4
Funding $2,282,809.66
PubMed Score 4.38
PubTator Score 4.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
22509046 immunotoxin resistance is associated with reversible CpG island methylation and silencing of DPH4 gene transcription
22367199 We report here the solution structure and mechanism of novel iron-mediated functional roles of human Dph4, a type III J-protein playing a vital role in diphthamide biosynthesis and normal development.

AA Sequence

MAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGN      1 - 70
EETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSL     71 - 140
IIELLHYN                                                                  141 - 148
//

Text Mined References (9)

PMID Year Title
25027321 2014 Genome-wide association and admixture analysis of glaucoma in the Women's Health Initiative.
22509046 2012 Immunotoxin resistance via reversible methylation of the DPH4 promoter is a unique survival strategy.
22367199 2012 Structure and mechanistic insights into novel iron-mediated moonlighting functions of human J-protein cochaperone, Dph4.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485916 2004 Identification of the proteins required for biosynthesis of diphthamide, the target of bacterial ADP-ribosylating toxins on translation elongation factor 2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.