Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.38
PubTator Score 4.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Glaucoma 135
Disease Target Count P-value
ovarian cancer 8492 2.222735649405E-9
osteosarcoma 7933 5.0667824529374E-7
hepatocellular carcinoma 550 7.31551928258962E-7
medulloblastoma, large-cell 6234 1.47311818400463E-4
gastric cancer 436 4.26929279770955E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00192811056545088
lung cancer 4473 0.00253194086629373
pancreatic cancer 2300 0.00275067692124443
pancreatic carcinoma 567 0.00275067692124444
tuberculosis and treatment for 6 months 686 0.00317538806859721
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00990044877163458
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0367694536290705
Disease Target Count Z-score Confidence
Aniridia 26 4.02 2.0

Expression

Synonym

Accession Q6P3W2 A8K0V0 B1ALC1 I6L9B4
Symbols DPH4
JJJ3
ZCSL3

Gene

PDB

2L6L  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (2)

PMID Text
22509046 immunotoxin resistance is associated with reversible CpG island methylation and silencing of DPH4 gene transcription
22367199 We report here the solution structure and mechanism of novel iron-mediated functional roles of human Dph4, a type III J-protein playing a vital role in diphthamide biosynthesis and normal development.

AA Sequence

MAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGN      1 - 70
EETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSL     71 - 140
IIELLHYN                                                                  141 - 148
//

Text Mined References (9)

PMID Year Title
25027321 2014 Genome-wide association and admixture analysis of glaucoma in the Women's Health Initiative.
22509046 2012 Immunotoxin resistance via reversible methylation of the DPH4 promoter is a unique survival strategy.
22367199 2012 Structure and mechanistic insights into novel iron-mediated moonlighting functions of human J-protein cochaperone, Dph4.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485916 2004 Identification of the proteins required for biosynthesis of diphthamide, the target of bacterial ADP-ribosylating toxins on translation elongation factor 2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.