Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.38
PubTator Score 4.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (2)

AA Sequence

MAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGN      1 - 70
EETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSL     71 - 140
IIELLHYN                                                                  141 - 148
//

Text Mined References (9)

PMID Year Title