Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 5.65127652747068E-22
osteosarcoma 7933 1.9695478309491E-6
hepatocellular carcinoma 550 4.47386706266296E-6
tuberculosis and treatment for 6 months 686 9.10499457518764E-5
cystic fibrosis 1670 3.72929570963456E-4
medulloblastoma, large-cell 6234 5.76105292283894E-4
gastric cancer 436 8.3257052826662E-4
adrenocortical carcinoma 1427 0.00125340488208754
pancreatic cancer 2300 0.00163654243665091
pancreatic carcinoma 567 0.00163654243665091
glioblastoma 5572 0.00706589801643989
ependymoma 2514 0.0291819153932401
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.300 0.001
hepatocellular carcinoma 1.400 0.000
pancreatic cancer 1.100 0.002
ependymoma 1.300 0.029
osteosarcoma -1.209 0.000
cystic fibrosis 1.141 0.000
glioblastoma -1.100 0.007
medulloblastoma, large-cell -1.400 0.001
adrenocortical carcinoma 1.032 0.001
tuberculosis and treatment for 6 months -1.200 0.000
pancreatic carcinoma 1.100 0.002
lung carcinoma 1.100 0.000

Synonym

Accession Q6P3V2 Q8TE95 Q96MV3
Symbols

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

AA Sequence

MPANWTSPQKSSALAPEDHGSSYEGSVSFRDVAIDFSREEWRHLDPSQRNLYRDVMLETYSHLLSVGYQV      1 - 70
PEAEVVMLEQGKEPWALQGERPRQSCPGEKLWDHNQCRKILSYKQVSSQPQKMYPGEKAYECAKFEKIFT     71 - 140
QKSQLKVHLKVLAGEKLYVCIECGKAFVQKPEFIIHQKTHMREKPFKCNECGKSFFQVSSLFRHQRIHTG    141 - 210
EKLYECSQCGKGFSYNSDLSIHEKIHTGERHHECTDCGKAFTQKSTLKMHQKIHTGERSYICIECGQAFI    211 - 280
QKTHLIAHRRIHTGEKPYECSNCGKSFISKSQLQVHQRVHTRVKPYICTEYGKVFSNNSNLVTHKKVQSR    281 - 350
EKSSICTECGKAFTYRSELIIHQRIHTGEKPYECSDCGKAFTQKSALTVHQRIHTGEKSYICMKCGLAFI    351 - 420
QKAHLIAHQIIHTGEKPHKCGHCGKLFTSKSQLHVHKRIHTGEKPYMCNKCGKAFTNRSNLITHQKTHTG    421 - 490
EKSYICSKCGKAFTQRSDLITHQRIHTGEKPYECNTCGKAFTQKSHLNIHQKIHTGERQYECHECGKAFN    491 - 560
QKSILIVHQKIHTGEKPYVCTECGRAFIRKSNFITHQRIHTGEKPYECSDCGKSFTSKSQLLVHQPVHTG    561 - 630
EKPYVCAECGKAFSGRSNLSKHQKTHTGEKPYICSECGKTFRQKSELITHHRIHTGEKPYECSDCGKSFT    631 - 700
KKSQLQVHQRIHTGEKPYVCAECGKAFTDRSNLNKHQTTHTGDKPYKCGICGKGFVQKSVFSVHQSSHA     701 - 769
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.