Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.59
PubTator Score 8.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.500 2.6e-04
Breast cancer 2.300 4.1e-02
breast carcinoma 1.300 2.2e-20
cystic fibrosis 1.437 5.6e-05
ductal carcinoma in situ 1.800 6.6e-05
group 3 medulloblastoma 2.200 1.3e-05
hepatocellular carcinoma -1.100 2.4e-02
intraductal papillary-mucinous adenoma (... 2.700 9.7e-04
intraductal papillary-mucinous carcinoma... 2.800 1.6e-03
intraductal papillary-mucinous neoplasm ... 2.000 2.5e-02
invasive ductal carcinoma 1.068 1.2e-02
lung cancer -1.600 7.9e-03
medulloblastoma, large-cell 1.200 2.3e-02
Multiple myeloma 1.429 4.6e-02
non primary Sjogren syndrome sicca -1.400 1.8e-02
osteosarcoma 2.483 1.8e-05
ovarian cancer -1.600 1.2e-05
Pick disease 1.100 5.7e-04
primitive neuroectodermal tumor 1.300 2.8e-03
psoriasis 1.100 5.6e-10
Rheumatoid arthritis 2.500 1.5e-05
sarcoidosis 1.400 1.2e-02
tuberculosis -1.100 1.4e-04

Protein-protein Interaction (1)

Gene RIF (8)

AA Sequence

MDCRTKANPDRTFDLVLKVKCHASENEDPVVLWKFPEDFGDQEILQSVPKFCFPFDVERVSQNQVGQHFT      1 - 70
FVLTDIESKQRFGFCRLTSGGTICLCILSYLPWFEVYYKLLNTLADYLAKELENDLNETLRSLYNHPVPK     71 - 140
ANTPVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEYFVAVDVNNMLQLYASML    141 - 210
HERRIVIISSKLSTLTACIHGSAALLYPMYWQHIYIPVLPPHLLDYCCAPMPYLIGIHSSLIERVKNKSL    211 - 280
EDVVMLNVDTNTLESPFSDLNNLPSDVVSALKNKLKKQSTATGDGVARAFLRAQAALFGSYRDALRYKPG    281 - 350
EPITFCEESFVKHRSSVMKQFLETAINLQLFKQFIDGRLAKLNAGRGFSDVFEEEITSGGFCGGNPRSYQ    351 - 420
QWVHTVKKGGALFNTAMTKATPAVRTAYKFAKNHAKLGLKEVKSKLKHKENEEDYGTCSSSVQYTPVYKL    421 - 490
HNEKGGNSEKRKLAQARLKRPLKSLDGALYDDEDDDDIERASKLSSEDGEEASAYLYESDDSVETRVKTP    491 - 560
YSGEMDLLGEILDTLSTHSSDQGKLAAAKSLDFFRSMDDIDYKPTNKSNAPSENNLAFLCGGSGDQAEWN    561 - 630
LGQDDSALHGKHLPPSPRKRVSSSGLTDSLFILKEENSNKHLGADNVSDPTSGLDFQLTSPEVSQTDKGK    631 - 700
TEKRETLSQISDDLLIPGLGRHSSTFVPWEKEGKEAKETSEDIGLLHEVVSLCHMTSDFQQSLNISDKNT    701 - 770
NGNQT                                                                     771 - 775
//

Text Mined References (26)

PMID Year Title