Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
ependymoma 2,514
ovarian cancer 8,484

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 1.100 0.019
ovarian cancer -1.600 0.000

Synonym

Accession Q6P2I7 Q8WWH3 Q9NW89
Symbols EBLN-2

Gene

AA Sequence

MGYFLKLYAYVNSHSLFVWVCDRSYKRSFRPMILNKIKELSRNQFSTMSHLRKDSQPSSPGDDAMDRSGL      1 - 70
PDLQGRFELSGKNRQYPLDALEPQPSIGDIKDIKKAAKSMLDPAHKSHFHPVTPSLVFLCFIFDGLHQAL     71 - 140
LSVGVSKRSNTVVGNENEERGTPYASRFKDMPNFIALEKSSVLRHCCDLLIGIAAGSSDKICTSSLQVQR    141 - 210
RFKAMMASIGRLSHGESADLLISCNAESAIGWISSRPWVGELMFTLLFGDFESPLHKLRKSS            211 - 272
//

Text Mined References (7)

PMID Year Title
20686665 2010 Unexpected inheritance: multiple integrations of ancient bornavirus and ebolavirus/marburgvirus sequences in vertebrate genomes.
20054395 2010 Endogenous non-retroviral RNA virus elements in mammalian genomes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.