Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8519 4.4e-10
ependymoma 4679 1.9e-02

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 1.100 1.9e-02
ovarian cancer -1.600 4.4e-10

AA Sequence

MGYFLKLYAYVNSHSLFVWVCDRSYKRSFRPMILNKIKELSRNQFSTMSHLRKDSQPSSPGDDAMDRSGL      1 - 70
PDLQGRFELSGKNRQYPLDALEPQPSIGDIKDIKKAAKSMLDPAHKSHFHPVTPSLVFLCFIFDGLHQAL     71 - 140
LSVGVSKRSNTVVGNENEERGTPYASRFKDMPNFIALEKSSVLRHCCDLLIGIAAGSSDKICTSSLQVQR    141 - 210
RFKAMMASIGRLSHGESADLLISCNAESAIGWISSRPWVGELMFTLLFGDFESPLHKLRKSS            211 - 272
//

Text Mined References (7)

PMID Year Title