Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.52
PubTator Score 0.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 1.6e-06
medulloblastoma, large-cell 6241 6.2e-06
osteosarcoma 7950 2.5e-03
lung cancer 4740 9.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Endometriosis 540 3.033 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.200 9.5e-03
malignant mesothelioma 1.700 1.6e-06
medulloblastoma, large-cell 1.300 6.2e-06
osteosarcoma 1.150 2.5e-03

Gene RIF (2)

AA Sequence

MAMQEKYPTEGISHVTSPSSDVIQKGSSLGTEWQTPVISEPFRSRFSRCSSVADSGDTAIGTSCSDIAED      1 - 70
FCSSSGSPPFQPIKSHVTIPTAHVMPSTLGTSPAKPNSTPVGPSSSKLPLSGLAESVGMTRNGDLGAMKH     71 - 140
SPGLSRDLMYFSGATGENGIEQSWFPAVGHERQEEARKFDIPSMESTLNQSAMMETLYSDPHHRVRFHNP    141 - 210
RTSTSKELYRVLPEAKKAPGSGAVFERNGPHSNSSGVLPLGLQPAPGLSKPLPSQVWQPSPDTWHPREQS    211 - 280
CELSTCRQQLELIRLQMEQMQLQNGAICHHPAAFGPSLPILEPAQWISILNSNEHLLKEKELLIDKQRKH    281 - 350
ISQLEQKVRESELQVHSALLGRPAPFGDVCLLRLQELQRENTFLRAQFAQKTEALSREKIDLEKKLSASE    351 - 420
VEVQLIRESLKVALQKHSEEVKKQEERVKGRDKHINNLKKKCQKESEQNREKQQRIETLERYLADLPTLE    421 - 490
DHQKQSQQLKDSELKSTELQEKVTELESLLEETQAICREKEIQLESLRQREAEFSSAGHSLQDKQSVEET    491 - 560
SGEGPEVEMESWQKRYDSLQKIVEKQQQKMDQLRSQVQSLEQEVAQEEGTSQALREEAQRRDSALQQLRT    561 - 630
AVKELSVQNQDLIEKNLTLQEHLRQAQPGSPPSPDTAQLALELHQELASCLQDLQAVCSIVTQRAQGHDP    631 - 700
NLSLLLGIHSAQHPETQLDLQKPDVIKRKLEEVQQLRRDIEDLRTTMSDRYAQDMGENCVTQ            701 - 762
//

Text Mined References (16)

PMID Year Title