Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.17
PubTator Score 3.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 6.29455147078423E-10
aldosterone-producing adenoma 664 0.00470201135080584
non primary Sjogren syndrome sicca 840 0.0278330490227544

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.502 0.000
non primary Sjogren syndrome sicca -1.300 0.028
aldosterone-producing adenoma -1.214 0.005

Synonym

Accession Q6P1S2 A8K1H5 Q86YE6 Q8IXA7 Q96NB5
Symbols AC3-33

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (2)

PMID Text
20680465 AC3-33 is a novel member of the secretory family and inhibits Elk1 transcriptional activity via ERK1/2 MAP
18487146 The preliminary results showed that AC3-33 is an important novel gene related to supress AP-1 activity.

AA Sequence

MAGQPAATGSPSADKDGMEPNVVARISQWADDHLRLVRNISTGMAIAGIMLLLRSIRLTSKFTSSSDIPV      1 - 70
EFIRRNVKLRGRLRRITENGLEIEHIPITLPIIASLRKEPRGALLVKLAGVELAETGKAWLQKELKPSQL     71 - 140
LWFQLLGKENSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHRNLLKAELTALK    141 - 210
KGEGIWKEDSEKESYLEKFKDSWREIWKKDSFLKTTGSDFSLKKESYYEKLKRTYEIWKDNMNNCSLILK    211 - 280
FRELISRINFRRKG                                                            281 - 294
//

Text Mined References (10)

PMID Year Title
26137149 2015 Analysis of AC3-33 gene expression in multiple organ cancer and adjacent normal tissue by RNA in situ hybridization.
20680465 2011 AC3-33, a novel secretory protein, inhibits Elk1 transcriptional activity via ERK pathway.
20515784 2010 Prokaryotic expression and characterization of human AC3-33 protein.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18487146 2008 [Molecular cloning and preliminary function study of a novel human gene AC3-33 related to suppress AP-1 activity].
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.