Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.12
PubTator Score 3.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
aldosterone-producing adenoma -1.214 4.7e-03
non primary Sjogren syndrome sicca -1.300 2.8e-02
osteosarcoma -2.502 6.3e-10

Gene RIF (2)

AA Sequence

MAGQPAATGSPSADKDGMEPNVVARISQWADDHLRLVRNISTGMAIAGIMLLLRSIRLTSKFTSSSDIPV      1 - 70
EFIRRNVKLRGRLRRITENGLEIEHIPITLPIIASLRKEPRGALLVKLAGVELAETGKAWLQKELKPSQL     71 - 140
LWFQLLGKENSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHRNLLKAELTALK    141 - 210
KGEGIWKEDSEKESYLEKFKDSWREIWKKDSFLKTTGSDFSLKKESYYEKLKRTYEIWKDNMNNCSLILK    211 - 280
FRELISRINFRRKG                                                            281 - 294
//

Text Mined References (10)

PMID Year Title