Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.17
PubTator Score 3.87

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.502 0.000
non primary Sjogren syndrome sicca -1.300 0.028
aldosterone-producing adenoma -1.214 0.005

Gene RIF (2)

PMID Text
20680465 AC3-33 is a novel member of the secretory family and inhibits Elk1 transcriptional activity via ERK1/2 MAP
18487146 The preliminary results showed that AC3-33 is an important novel gene related to supress AP-1 activity.

AA Sequence

MAGQPAATGSPSADKDGMEPNVVARISQWADDHLRLVRNISTGMAIAGIMLLLRSIRLTSKFTSSSDIPV      1 - 70
EFIRRNVKLRGRLRRITENGLEIEHIPITLPIIASLRKEPRGALLVKLAGVELAETGKAWLQKELKPSQL     71 - 140
LWFQLLGKENSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHRNLLKAELTALK    141 - 210
KGEGIWKEDSEKESYLEKFKDSWREIWKKDSFLKTTGSDFSLKKESYYEKLKRTYEIWKDNMNNCSLILK    211 - 280
FRELISRINFRRKG                                                            281 - 294
//

Text Mined References (10)

PMID Year Title
26137149 2015 Analysis of AC3-33 gene expression in multiple organ cancer and adjacent normal tissue by RNA in situ hybridization.
20680465 2011 AC3-33, a novel secretory protein, inhibits Elk1 transcriptional activity via ERK pathway.
20515784 2010 Prokaryotic expression and characterization of human AC3-33 protein.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18487146 2008 [Molecular cloning and preliminary function study of a novel human gene AC3-33 related to suppress AP-1 activity].
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.