Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.86
PubTator Score 0.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Liver carcinoma 217

Expression

Gene RIF (1)

PMID Text
18976975 Knockdown of TatD DNase domain containing 1 (TATDN1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSRFKFIDIGINLTDPMFRGIYRGVQKHQDDLQDVIGRAVEIGVKKFMITGGNLQDSKDALHLAQTNGMF      1 - 70
FSTVGCHPTRCGEFEKNNPDLYLKELLNLAENNKGKVVAIGECGLDFDRLQFCPKDTQLKYFEKQFELSE     71 - 140
QTKLPMFLHCRNSHAEFLDIMKRNRDRCVGGVVHSFDGTKEAAAALIDLDLYIGFNGCSLKTEANLEVLK    141 - 210
SIPSEKLMIETDAPWCGVKSTHAGSKYIRTAFPTKKKWESGHCLKDRNEPCHIIQILEIMSAVRDEDPLE    211 - 280
LANTLYNNTIKVFFPGI                                                         281 - 297
//

Text Mined References (7)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
15846844 2005 Proteomic profiling of cellular proteins interacting with the hepatitis C virus core protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14713272 2003 The gene expression profiling of sporadic pheochromocytoma and novel full-length cDNAs cloning.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.