Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.86
PubTator Score 0.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma, Hepatocellular 228 0.0 0.0
Disease Target Count
Liver carcinoma 240
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

Gene RIF (2)

AA Sequence

MSRFKFIDIGINLTDPMFRGIYRGVQKHQDDLQDVIGRAVEIGVKKFMITGGNLQDSKDALHLAQTNGMF      1 - 70
FSTVGCHPTRCGEFEKNNPDLYLKELLNLAENNKGKVVAIGECGLDFDRLQFCPKDTQLKYFEKQFELSE     71 - 140
QTKLPMFLHCRNSHAEFLDIMKRNRDRCVGGVVHSFDGTKEAAAALIDLDLYIGFNGCSLKTEANLEVLK    141 - 210
SIPSEKLMIETDAPWCGVKSTHAGSKYIRTAFPTKKKWESGHCLKDRNEPCHIIQILEIMSAVRDEDPLE    211 - 280
LANTLYNNTIKVFFPGI                                                         281 - 297
//

Text Mined References (8)

PMID Year Title