Property Summary

NCBI Gene PubMed Count 19
Grant Count 7
R01 Count 5
Funding $695,335.01
PubMed Score 5.35
PubTator Score 24.93

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
24513855 The crystal structures of the Dlg4 GK domain in complex with two phosphor-Lgl2 peptides reveal the molecular mechanism underlying the specific and phosphorylation-dependent Dlg/Lgl complex formation.
24318287 It is correlated with lymphatic invasion and lymph node metastasis.
23332925 Loss or aberrant Lgl2 staining was useful in identifying Barrett gastric foveolar dysplasia
23110097 Hugl1 and Hugl2 play an essential role in the maintenance of breast epithelial polarity and differentiated cell morphology, as well as growth control.
22580609 Hugl-2 induces MET and suppresses Snail tumorigenesis.
20941506 There is a role of Lgl2 immunohistochemistry as an adjunct in the diagnosis of foveolar-type gastric dysplasia.
20233622 Lgl2 differentiates pancreatic intraepithelial neoplasia-3 and ductal adenocarcinoma of the pancreas from lower-grade pancreatic intraepithelial neoplasias.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19407852 We propose that Lgl2 may be a potential marker to rule out gastric epithelial dysplasia and adenocarcinoma in diagnostic specimens.
More...

AA Sequence

MRRFLRPGHDPVRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLH      1 - 70
QENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSS     71 - 140
CELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSR    141 - 210
GLVVIWDLQGSRVLYHFLSSQQLENIWWQRDGRLLVSCHSDGSYCQWPVSSEAQQPEPLRSLVPYGPFPC    211 - 280
KAITRILWLTTRQGLPFTIFQGGMPRASYGDRHCISVIHDGQQTAFDFTSRVIGFTVLTEADPAATFDDP    281 - 350
YALVVLAEEELVVIDLQTAGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQNAHFSTMEW    351 - 420
PIDGGTSLTPAPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGEDEWPPL    421 - 490
RKVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQDQEGYRWKG    491 - 560
HERLAARSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSEWRLVAFGTSHGFGLFDHQQRRQVFVKCTLHP    561 - 630
SDQLALEGPLSRVKSLKKSLRQSFRRMRRSRVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKI    631 - 700
EARSAEDSFTGFVRTLYFADTYLKDSSRHCPSLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQL    701 - 770
MHRAPVVGILVLDGHSVPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEG    771 - 840
SRVRRVSVAHFGSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIRREDVSGIASCVFTKYGQGF    841 - 910
YLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQPGLVMERAL    911 - 980
LSDERVLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE                                  981 - 1020
//

Text Mined References (25)

PMID Year Title
24513855 2014 Phosphorylation-dependent interaction between tumor suppressors Dlg and Lgl.
24318287 2013 Localization of aPKC lambda/iota and its interacting protein, Lgl2, is significantly associated with lung adenocarcinoma progression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23332925 2013 Distinguishing Barrett gastric foveolar dysplasia from reactive cardiac mucosa in gastroesophageal reflux disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23110097 2012 Hugl1 and Hugl2 in mammary epithelial cells: polarity, proliferation, and differentiation.
22580609 2013 The human Lgl polarity gene, Hugl-2, induces MET and suppresses Snail tumorigenesis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20941506 2010 Loss of cell polarity protein Lgl2 in foveolar-type gastric dysplasia: correlation with expression of the apical marker aPKC-zeta.
20644714 2010 Involvement of Lgl and Mahjong/VprBP in cell competition.
More...