Property Summary

NCBI Gene PubMed Count 114
PubMed Score 286.27
PubTator Score 209.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Protein-protein Interaction (3)

Gene RIF (87)

AA Sequence

MADVLSVLRQYNIQKKEIVVKGDEVIFGEFSWPKNVKTNYVVWGTGKEGQPREYYTLDSILFLLNNVHLS      1 - 70
HPVYVRRAATENIPVVRRPDRKDLLGYLNGEASTSASIDRSAPLEIGLQRSTQVKRAADEVLAEAKKPRI     71 - 140
EDEECVRLDKERLAARLEGHKEGIVQTEQIRSLSEAMSVEKIAAIKAKIMAKKRSTIKTDLDDDITALKQ    141 - 210
RSFVDAEVDVTRDIVSRERVWRTRTTILQSTGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVDPTL    211 - 280
RTKQPIPAAYNRYDQERFKGKEETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPP    281 - 350
PNQKKGSRTPIIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAIS    351 - 420
VTVPYRVVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQ    421 - 490
KWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHLRF                                 491 - 531
//

Text Mined References (123)

PMID Year Title