Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.03
PubTator Score 4.60

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6NZY7 B0VJZ2 Q8TB51
Symbols CEP5
Borg3

Gene

AA Sequence

MPVLKQLGPAQPKKRPDRGALSISAPLGDFRHTLHVGRGGDAFGDTSFLSRHGGGPPPEPRAPPAGAPRS      1 - 70
PPPPAVPQSAAPSPADPLLSFHLDLGPSMLDAVLGVMDAARPEAAAAKPDAEPRPGTQPPQARCRPNADL     71 - 140
ELNDVIGL                                                                  141 - 148
//

Text Mined References (7)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11584266 2001 Borg proteins control septin organization and are negatively regulated by Cdc42.
11035016 2001 A new family of Cdc42 effector proteins, CEPs, function in fibroblast and epithelial cell shape changes.
10490598 1999 The Borgs, a new family of Cdc42 and TC10 GTPase-interacting proteins.