Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.15
PubTator Score 4.60

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6NZY7 B0VJZ2 Q8TB51
Symbols CEP5
Borg3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MPVLKQLGPAQPKKRPDRGALSISAPLGDFRHTLHVGRGGDAFGDTSFLSRHGGGPPPEPRAPPAGAPRS      1 - 70
PPPPAVPQSAAPSPADPLLSFHLDLGPSMLDAVLGVMDAARPEAAAAKPDAEPRPGTQPPQARCRPNADL     71 - 140
ELNDVIGL                                                                  141 - 148
//

Text Mined References (8)

PMID Year Title