Property Summary

NCBI Gene PubMed Count 8
PubMed Score 34.66
PubTator Score 20.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.5e-04
Disease Target Count Z-score Confidence
Dental caries 164 4.03 2.0
Root resorption 22 3.048 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.089 2.5e-04

Gene RIF (2)

AA Sequence

MAAAAGDADDEPRSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGGAQSPLRYLHV      1 - 70
LWQQDAEPRDELRCKIPAGRLRRAARPHRRLGPTGKEVHALKRLRDSANANDVETVQQLLEDGADPCAAD     71 - 140
DKGRTALHFASCNGNDQIVQLLLDHGADPNQRDGLGNTPLHLAACTNHVPVITTLLRGGARVDALDRAGR    141 - 210
TPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEV    211 - 280
TDLLASFTSLSLQMQSMEKR                                                      281 - 300
//

Text Mined References (14)

PMID Year Title