Property Summary

NCBI Gene PubMed Count 5
PubMed Score 12.41
PubTator Score 1.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.0e-12
ovarian cancer 8520 1.0e-04
group 4 medulloblastoma 1855 1.6e-02
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.1

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 1.100 1.6e-02
osteosarcoma -3.311 3.0e-12
ovarian cancer -1.100 1.0e-04

Protein-protein Interaction (9)

AA Sequence

MMAAVPPGLEPWNRVRIPKAGNRSAVTVQNPGAALDLCIAAVIKECHLVILSLKSQTLDAETDVLCAVLY      1 - 70
SNHNRMGRHKPHLALKQVEQCLKRLKNMNLEGSIQDLFELFSSNENQPLTTKVCVVPSQPVVELVLMKVL     71 - 140
GACKLLLRLLDCCCKTFLLTVKHLGLQEFIILNLVMVGLVSRLWVLYKGVLKRLILLYEPLFGLLQEVAR    141 - 210
IQPMPYFKDFTFPSDITEFLGQPYFEAFKKKMPIAFAAKGINKLLNKLFLINEQSPRASEETLLGISKKA    211 - 280
KQMKINVQNNVDLGQPVKNKRVFKEESSEFDVRAFCNQLKHKATQETSFDFKCSQSRLKTTKYSSQKVIG    281 - 350
TPHAKSFVQRFREAESFTQLSEEIQMAVVWCRSKKLKAQAIFLGNKLLKSNRLKHLEAQGTSLPKKLECI    351 - 420
KTSICNHLLRGSGIKTSKHHLRQRRSQNKFLRRQRKPQRKLQSTLLREIQQFSQGTRKSATDTSAKWRLS    421 - 490
HCTVHRTDLYPNSKQLLNSGVSMPVIQTKEKMIHENLRGIHENETDSWTVMQINKNSTSGTIKETDDIDD    491 - 560
IFALMGV                                                                   561 - 567
//

Text Mined References (10)

PMID Year Title