Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.47
PubTator Score 1.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma 2.529 0.000
ependymoma 1.400 0.000
glioblastoma 2.700 0.000
atypical teratoid / rhabdoid tumor 2.300 0.000
medulloblastoma 1.600 0.001
primary pancreatic ductal adenocarcinoma 2.171 0.000
pancreatic cancer 1.700 0.006
pediatric high grade glioma 2.000 0.000
pilocytic astrocytoma 2.000 0.000
aldosterone-producing adenoma -1.618 0.015
spina bifida -2.112 0.037
Pick disease -1.300 0.021
progressive supranuclear palsy -1.700 0.013

Synonym

Accession Q6NUK4 Q5JQR5 Q5QGT2 Q6PEW8 Q6PJY4
Symbols Yip2b
C10orf74

Gene

PANTHER Protein Class (1)

Gene RIF (5)

PMID Text
23911198 Our results show that REEP3/4 function redundantly to clear the endoplasmic reticulum from metaphase chromatin, thereby ensuring correct progression through mitosis and proper nuclear envelope architecture.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18940312 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
17290275 Receptor Expression-Enhancing Proteins (REEP) 3 is one of the six human homologs of yeast Yop1p, a probable regulator of cellular vesicle trafficking between the endoplasmatic reticulum and the Golgi network. Positional candidate gene for autism.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTVAWFPLYYELKI      1 - 70
AFVIWLLSPYTKGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVNFGRQGLNLAATAAVTAAVKS     71 - 140
QGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKSKPAPSESAGYGIPLKDGDEKTDEEAEGPYS    141 - 210
DNEMLTHKGLRRSQSMKSVKTTKGRKEVRYGSLKYKVKKRPQVYF                             211 - 255
//

Text Mined References (20)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23911198 2013 REEP3/4 ensure endoplasmic reticulum clearance from metaphase chromatin and proper nuclear envelope architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22936694 2012 Genome-wide association study identifies a new locus JMJD1C at 10q21 that may influence serum androgen levels in men.
22354554 2012 Genome-wide association analysis of juvenile idiopathic arthritis identifies a new susceptibility locus at chromosomal region 3q13.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...