Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.17
PubTator Score 1.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
aldosterone-producing adenoma -1.618 1.5e-02
Astrocytoma, Pilocytic 1.500 3.3e-05
atypical teratoid / rhabdoid tumor 2.300 1.0e-04
ependymoma 1.400 4.1e-05
glioblastoma 1.200 4.1e-03
group 4 medulloblastoma 1.500 2.9e-03
osteosarcoma 2.529 1.8e-04
pancreatic cancer 1.100 9.5e-04
pediatric high grade glioma 1.100 1.5e-03
Pick disease -1.300 2.1e-02
primary pancreatic ductal adenocarcinoma 2.171 9.5e-05
progressive supranuclear palsy -1.700 1.3e-02
spina bifida -2.112 3.7e-02

Gene RIF (5)

AA Sequence

MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTVAWFPLYYELKI      1 - 70
AFVIWLLSPYTKGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVNFGRQGLNLAATAAVTAAVKS     71 - 140
QGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKSKPAPSESAGYGIPLKDGDEKTDEEAEGPYS    141 - 210
DNEMLTHKGLRRSQSMKSVKTTKGRKEVRYGSLKYKVKKRPQVYF                             211 - 255
//

Text Mined References (20)

PMID Year Title