Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.25
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

AA Sequence

MASWGGEKRGGAGGSPKPAVYATRKTPSVGSQEDQWYLDYPGDQWSLGFSYSWWKNSVGSESKHGEGALD      1 - 70
QLQHDVRLEDLGELHRAARSGDVPGVEHVLAPGDTGVDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPAA     71 - 140
PSQAEGGEGGVACGTVEQMTWLCSLPHAVGGGDGDHSSTGAVGGHPRGPGEYCHLHEQRVHHHIFARGKR    141 - 210
KGKNHVSNVVR                                                               211 - 221
//

Text Mined References (3)

PMID Year Title