Property Summary

NCBI Gene PubMed Count 12
PubMed Score 107.15
PubTator Score 39.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
inflammatory breast cancer -1.700 2.1e-06
interstitial cystitis -2.500 1.1e-03
psoriasis 1.100 2.1e-16

Gene RIF (4)

AA Sequence

MLPITDRLLHLLGLEKTAFRIYAVSTLLLFLLFFLFRLLLRFLRLCRSFYITCRRLRCFPQPPRRNWLLG      1 - 70
HLGMYLPNEAGLQDEKKVLDNMHHVLLVWMGPVLPLLVLVHPDYIKPLLGASAAIAPKDDLFYGFLKPWL     71 - 140
GDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFNQSADIMHAKWRHLAEGSAVSLDMFEHISLMTLDS    141 - 210
LQKCVFSYNSNCQEKMSDYISAIIELSALSVRRQYRLHHYLDFIYYRSADGRRFRQACDMVHHFTTEVIQ    211 - 280
ERRRALRQQGAEAWLKAKQGKTLDFIDVLLLARDEDGKELSDEDIRAEADTFMFEGHDTTSSGISWMLFN    281 - 350
LAKYPEYQEKCREEIQEVMKGRELEELEWDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDGRI    351 - 420
IPKGIICLVSIYGTHHNPTVWPDSKVYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSFAMAELRVVVA    421 - 490
LTLLRFRLSVDRTRKVRRKPELILRTENGLWLKVEPLPPRA                                 491 - 531
//

Text Mined References (13)

PMID Year Title