Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 3.0e-07

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 3.0e-07

AA Sequence

MATPPFRLIRKMFSFKVSRWMGLACFRSLAASSPSIRQKKLMHKLQEEKAFREEMKIFREKIEDFREEMW      1 - 70
TFRGKIHAFRGQILGFWEEERPFWEEEKTFWKEEKSFWEMEKSFREEEKTFWKKYRTFWKEDKAFWKEDN     71 - 140
ALWERDRNLLQEDKALWEEEKALWVEERALLEGEKALWEDKTSLWEEENALWEEERAFWMENNGHIAGEQ    141 - 210
MLEDGPHNANRGQRLLAFSRGRA                                                   211 - 233
//

Text Mined References (10)

PMID Year Title