Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.19
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy -1.371 1.8e-05
Astrocytoma, Pilocytic -1.500 2.7e-05
atypical teratoid / rhabdoid tumor -1.100 1.9e-03
Duchenne muscular dystrophy -1.209 1.1e-06
glioblastoma -1.100 7.4e-04
group 3 medulloblastoma -2.300 5.6e-05
medulloblastoma, large-cell -1.800 2.1e-05
osteosarcoma 1.154 5.7e-03
ovarian cancer 1.800 4.1e-07
pancreatic ductal adenocarcinoma liver m... -1.070 6.1e-03
ulcerative colitis -1.200 4.2e-03

Gene RIF (1)

AA Sequence

MLQNPQEKSQAYPRRRRPGCYAYRQNPEAIAAAAMYTFLPDNFSPAKPKPSKDLKPLLGSAVLGLLLVLA      1 - 70
AVVAWCYYSVSLRKAERLRAELLDLKAGGFSIRNQKGEQVFRLAFRSGALDLDSCSRDGALLGCSLTADG     71 - 140
LPLHFFIQTVRPKDTVMCYRVRWEEAAPGRAVEHAMFLGDAAAHWYGGAEMRTQHWPIRLDGQQEPQPFV    141 - 210
TSDVYSSDAAFGGILERYWLSSRAAAIKVNDSVPFHLGWNSTERSLRLQARYHDTPYKPPAGRAAAPELS    211 - 280
YRVCVGSDVTSIHKYMVRRYFNKPSRVPAPEAFRDPIWSTWALYGRAVDQDKVLRFAQQIRLHHFNSSHL    281 - 350
EIDDMYTPAYGDFDFDEVKFPNASDMFRRLRDAGFRVTLWVHPFVNYNSSRFGEGVERELFVREPTGRLP    351 - 420
ALVRWWNGIGAVLDFTHPKARDWFQGHLRRLRSRYSVASFKFDAGEVSYLPRDFSTYRPLPDPSVWSRRY    421 - 490
TEMALPFFSLAEVRVGYQSQNISCFFRLVDRDSVWGYDLGLRSLIPAVLTVSMLGYPFILPDMVGGNAVP    491 - 560
QRTAGGDVPERELYIRWLEVAAFMPAMQFSIPPWRYDAEVVAIAQKFAALRASLVAPLLLELAGEVTDTG    561 - 630
DPIVRPLWWIAPGDETAHRIDSQFLIGDTLLVAPVLEPGKQERDVYLPAGKWRSYKGELFDKTPVLLTDY    631 - 700
PVDLDEIAYFTWAS                                                            701 - 714
//

Text Mined References (8)

PMID Year Title