Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.86
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 4.08975064449419E-7
Duchenne muscular dystrophy 602 1.05333935450856E-6
acute quadriplegic myopathy 1157 1.80767251526783E-5
medulloblastoma, large-cell 6234 2.11559320588094E-5
atypical teratoid/rhabdoid tumor 1095 3.34768269134241E-5
pilocytic astrocytoma 3086 4.37358103215714E-5
group 3 medulloblastoma 2254 5.64265039055312E-5
glioblastoma 5572 7.39517985312324E-4
ulcerative colitis 2087 0.00422880374144228
osteosarcoma 7933 0.00568328262701061
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0060975230171867

Expression

  Differential Expression (11)

Synonym

Accession Q6NSJ0 Q5T587 Q5T588 Q9ULQ9
Symbols NET37

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
19204726 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLQNPQEKSQAYPRRRRPGCYAYRQNPEAIAAAAMYTFLPDNFSPAKPKPSKDLKPLLGSAVLGLLLVLA      1 - 70
AVVAWCYYSVSLRKAERLRAELLDLKAGGFSIRNQKGEQVFRLAFRSGALDLDSCSRDGALLGCSLTADG     71 - 140
LPLHFFIQTVRPKDTVMCYRVRWEEAAPGRAVEHAMFLGDAAAHWYGGAEMRTQHWPIRLDGQQEPQPFV    141 - 210
TSDVYSSDAAFGGILERYWLSSRAAAIKVNDSVPFHLGWNSTERSLRLQARYHDTPYKPPAGRAAAPELS    211 - 280
YRVCVGSDVTSIHKYMVRRYFNKPSRVPAPEAFRDPIWSTWALYGRAVDQDKVLRFAQQIRLHHFNSSHL    281 - 350
EIDDMYTPAYGDFDFDEVKFPNASDMFRRLRDAGFRVTLWVHPFVNYNSSRFGEGVERELFVREPTGRLP    351 - 420
ALVRWWNGIGAVLDFTHPKARDWFQGHLRRLRSRYSVASFKFDAGEVSYLPRDFSTYRPLPDPSVWSRRY    421 - 490
TEMALPFFSLAEVRVGYQSQNISCFFRLVDRDSVWGYDLGLRSLIPAVLTVSMLGYPFILPDMVGGNAVP    491 - 560
QRTAGGDVPERELYIRWLEVAAFMPAMQFSIPPWRYDAEVVAIAQKFAALRASLVAPLLLELAGEVTDTG    561 - 630
DPIVRPLWWIAPGDETAHRIDSQFLIGDTLLVAPVLEPGKQERDVYLPAGKWRSYKGELFDKTPVLLTDY    631 - 700
PVDLDEIAYFTWAS                                                            701 - 714
//

Text Mined References (7)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.