Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.38
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.100 0.002
group 3 medulloblastoma 1.100 0.016
pituitary cancer -1.100 0.008

AA Sequence

MVTLITEKLQSQSLDDLTCKAEAGPLQYSAETLNKSGRLFPLELNDQSPWKVFSGGPPVRSQAATGPDFS      1 - 70
FLPGLSAAAHTMGLQWQPQSPRPGAGLGAASTVDPSESTGSSTAPPTKRHCRSLSEPEELVRCRSPWRPG     71 - 140
SSKVWTPVSKRRCDSGGSATRQGSPGAVLPRSAVWSTGPTSPATPRPSSASGGFVDSSEGSAGSGPLWCS    141 - 210
AESCLPSTRRRPSLSQERLAGAGTPLPWASSSPTSTPALGGRRGLLRCRSQPCVLSGKRSRRKRRREEDA    211 - 280
RWTRPSLDFLKMTQTLKNSKSLCSLNYEDDDEDDTPVKTVLSSPCDSRGLPGITMPGCSQRGLRTSPVHP    281 - 350
NLWASRESVTSDGSRRSSGDPRDGDSVGEEGVFPRARWELDLEQIENN                          351 - 398
//

Text Mined References (7)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11984880 2002 Isolation of DNTNP, which encodes a potential nuclear protein that is expressed in the developing, dorsal neural tube.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.