Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.38
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
adult high grade glioma 2148 0.00199315901661034
pituitary cancer 1972 0.00770097822587417
group 3 medulloblastoma 2254 0.0159116662602803

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.100 0.002
group 3 medulloblastoma 1.100 0.016
pituitary cancer -1.100 0.008

Synonym

Accession Q6NSI3 Q6ZUL5
Symbols DNTNP

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MVTLITEKLQSQSLDDLTCKAEAGPLQYSAETLNKSGRLFPLELNDQSPWKVFSGGPPVRSQAATGPDFS      1 - 70
FLPGLSAAAHTMGLQWQPQSPRPGAGLGAASTVDPSESTGSSTAPPTKRHCRSLSEPEELVRCRSPWRPG     71 - 140
SSKVWTPVSKRRCDSGGSATRQGSPGAVLPRSAVWSTGPTSPATPRPSSASGGFVDSSEGSAGSGPLWCS    141 - 210
AESCLPSTRRRPSLSQERLAGAGTPLPWASSSPTSTPALGGRRGLLRCRSQPCVLSGKRSRRKRRREEDA    211 - 280
RWTRPSLDFLKMTQTLKNSKSLCSLNYEDDDEDDTPVKTVLSSPCDSRGLPGITMPGCSQRGLRTSPVHP    281 - 350
NLWASRESVTSDGSRRSSGDPRDGDSVGEEGVFPRARWELDLEQIENN                          351 - 398
//

Text Mined References (7)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11984880 2002 Isolation of DNTNP, which encodes a potential nuclear protein that is expressed in the developing, dorsal neural tube.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.