Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.38
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
adult high grade glioma 3801 2.0e-03
pituitary cancer 1972 7.7e-03
group 3 medulloblastoma 4104 1.6e-02

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.100 2.0e-03
group 3 medulloblastoma 1.100 1.6e-02
pituitary cancer -1.100 7.7e-03

Synonym

Accession Q6NSI3 Q6ZUL5
Symbols DNTNP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MVTLITEKLQSQSLDDLTCKAEAGPLQYSAETLNKSGRLFPLELNDQSPWKVFSGGPPVRSQAATGPDFS      1 - 70
FLPGLSAAAHTMGLQWQPQSPRPGAGLGAASTVDPSESTGSSTAPPTKRHCRSLSEPEELVRCRSPWRPG     71 - 140
SSKVWTPVSKRRCDSGGSATRQGSPGAVLPRSAVWSTGPTSPATPRPSSASGGFVDSSEGSAGSGPLWCS    141 - 210
AESCLPSTRRRPSLSQERLAGAGTPLPWASSSPTSTPALGGRRGLLRCRSQPCVLSGKRSRRKRRREEDA    211 - 280
RWTRPSLDFLKMTQTLKNSKSLCSLNYEDDDEDDTPVKTVLSSPCDSRGLPGITMPGCSQRGLRTSPVHP    281 - 350
NLWASRESVTSDGSRRSSGDPRDGDSVGEEGVFPRARWELDLEQIENN                          351 - 398
//

Text Mined References (8)

PMID Year Title