Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.33
PubTator Score 1.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 3.69027327983092E-15
posterior fossa group B ependymoma 1530 1.36004383424425E-9
pancreatic cancer 2300 7.73739377268229E-5
glioblastoma 5572 1.43047741566929E-4
pediatric high grade glioma 2712 1.66076078538961E-4
lung cancer 4473 1.79357473239219E-4
hepatocellular carcinoma 550 4.45374368146509E-4
ulcerative colitis 2087 7.01061372882321E-4
tuberculosis and treatment for 6 months 686 0.0011684263040041
gastric cancer 436 0.00326565011183471
urothelial carcinoma 318 0.00580836338669036
osteosarcoma 7933 0.00668462265371535

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.300 0.003
hepatocellular carcinoma 1.200 0.000
urothelial carcinoma -1.500 0.006
osteosarcoma 1.279 0.007
posterior fossa group B ependymoma 2.200 0.000
glioblastoma 1.600 0.000
tuberculosis and treatment for 6 months -1.900 0.001
lung cancer -2.300 0.000
ulcerative colitis -1.400 0.001
pancreatic cancer 1.200 0.000
pediatric high grade glioma 1.300 0.000
lung carcinoma -1.400 0.000

Synonym

Accession Q6MZQ0 A4QN22 E9PKY1 Q96H46 Q9H7V4
Symbols PROTOR2

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG

Gene RIF (3)

PMID Text
21964062 Protor-2 associates with tristetraprolin (TTP) to accelerate TTP-mediated mRNA turnover and functionally links the control of TTP-regulated mRNA stability to mTORC2 activity
20877624 Observational study of gene-disease association. (HuGE Navigator)
17461779 It was demonstrated that immunoprecipitation of Protor-1 or Protor-2 results in the co-immunoprecipitation of other mTORC2 subunits, but not Raptor, a specific component of mTORC1.

AA Sequence

MTRGFAPILPVEFHKMGSFRRPRPRFMSSPVLSDLPRFQAARQALQLSSSSAWNSVQTAVINVFKGGGLQ      1 - 70
SNELYALNENIRRLLKSELGSFITDYFQNQLLAKGLFFVEEKIKLCEGENRIEVLAEVWDHFFTETLPTL     71 - 140
QAIFYPVQGQELTIRQISLLGFRDLVLLKVKLGDLLLLAQSKLPSSIVQMLLILQSVHEPTGPSESYLQL    141 - 210
EELVKQVVSPFLGISGDRSFSGPTYTLARRHSRVRPKVTVLNYASPITAVSRPLNEMVLTPLTEQEGEAY    211 - 280
LEKCGSVRRHTVANAHSDIQLLAMATMMHSGLGEEASSENKCLLLPPSFPPPHRQCSSEPNITDNPDGLE    281 - 350
EGARGSQEGSELNCASLS                                                        351 - 368
//

Text Mined References (10)

PMID Year Title
22609986 2012 PRR5L degradation promotes mTORC2-mediated PKC-? phosphorylation and cell migration downstream of G?12.
21964062 2012 Protor-2 interacts with tristetraprolin to regulate mRNA stability during stress.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17461779 2007 Identification of Protor as a novel Rictor-binding component of mTOR complex-2.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.