Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.33
PubTator Score 1.05

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
active ulcerative colitis -1.198 1.3e-02
adult high grade glioma 1.200 4.5e-04
ependymoma 1.300 1.9e-05
gastric cancer 1.300 3.3e-03
glioblastoma 1.100 5.0e-03
hepatocellular carcinoma 1.200 4.5e-04
lung cancer -2.300 1.8e-04
lung carcinoma -1.400 3.7e-15
osteosarcoma 1.279 6.7e-03
pancreatic cancer 1.200 7.7e-05
tuberculosis and treatment for 3 months -1.300 1.8e-02
urothelial carcinoma -1.500 5.8e-03

Gene RIF (3)

AA Sequence

MTRGFAPILPVEFHKMGSFRRPRPRFMSSPVLSDLPRFQAARQALQLSSSSAWNSVQTAVINVFKGGGLQ      1 - 70
SNELYALNENIRRLLKSELGSFITDYFQNQLLAKGLFFVEEKIKLCEGENRIEVLAEVWDHFFTETLPTL     71 - 140
QAIFYPVQGQELTIRQISLLGFRDLVLLKVKLGDLLLLAQSKLPSSIVQMLLILQSVHEPTGPSESYLQL    141 - 210
EELVKQVVSPFLGISGDRSFSGPTYTLARRHSRVRPKVTVLNYASPITAVSRPLNEMVLTPLTEQEGEAY    211 - 280
LEKCGSVRRHTVANAHSDIQLLAMATMMHSGLGEEASSENKCLLLPPSFPPPHRQCSSEPNITDNPDGLE    281 - 350
EGARGSQEGSELNCASLS                                                        351 - 368
//

Text Mined References (10)

PMID Year Title