Property Summary

NCBI Gene PubMed Count 7
Grant Count 3
R01 Count 3
Funding $242,840.2
PubMed Score 3.33
PubTator Score 1.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.300 0.003
hepatocellular carcinoma 1.200 0.000
urothelial carcinoma -1.500 0.006
osteosarcoma 1.279 0.007
posterior fossa group B ependymoma 2.200 0.000
glioblastoma 1.600 0.000
tuberculosis and treatment for 6 months -1.900 0.001
lung cancer -2.300 0.000
ulcerative colitis -1.400 0.001
pancreatic cancer 1.200 0.000
pediatric high grade glioma 1.300 0.000
lung carcinoma -1.400 0.000

Gene RIF (3)

PMID Text
21964062 Protor-2 associates with tristetraprolin (TTP) to accelerate TTP-mediated mRNA turnover and functionally links the control of TTP-regulated mRNA stability to mTORC2 activity
20877624 Observational study of gene-disease association. (HuGE Navigator)
17461779 It was demonstrated that immunoprecipitation of Protor-1 or Protor-2 results in the co-immunoprecipitation of other mTORC2 subunits, but not Raptor, a specific component of mTORC1.

AA Sequence

MTRGFAPILPVEFHKMGSFRRPRPRFMSSPVLSDLPRFQAARQALQLSSSSAWNSVQTAVINVFKGGGLQ      1 - 70
SNELYALNENIRRLLKSELGSFITDYFQNQLLAKGLFFVEEKIKLCEGENRIEVLAEVWDHFFTETLPTL     71 - 140
QAIFYPVQGQELTIRQISLLGFRDLVLLKVKLGDLLLLAQSKLPSSIVQMLLILQSVHEPTGPSESYLQL    141 - 210
EELVKQVVSPFLGISGDRSFSGPTYTLARRHSRVRPKVTVLNYASPITAVSRPLNEMVLTPLTEQEGEAY    211 - 280
LEKCGSVRRHTVANAHSDIQLLAMATMMHSGLGEEASSENKCLLLPPSFPPPHRQCSSEPNITDNPDGLE    281 - 350
EGARGSQEGSELNCASLS                                                        351 - 368
//

Text Mined References (10)

PMID Year Title
22609986 2012 PRR5L degradation promotes mTORC2-mediated PKC-? phosphorylation and cell migration downstream of G?12.
21964062 2012 Protor-2 interacts with tristetraprolin to regulate mRNA stability during stress.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17461779 2007 Identification of Protor as a novel Rictor-binding component of mTOR complex-2.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.