Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.12
PubTator Score 11.97

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6L9W6 Q6ZNC1 Q8N7T6 B4GalNAcT3
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (9)

PMID Text
25803323 Identify a new chimeric transcript generated by the fusion of WNK1 and B4GALNT3 genes, correlated with B4GALNT3 overexpression papillary thyroid carcinoma.
25003232 Data suggest B4GALNT3 regulates cancer stemness and the invasive properties of colon cancer cells through modifying EGFR glycosylation and signaling.
22722940 Peptide-specific transfer of N-acetylgalactosamine to O-linked glycans by the glycosyltransferases beta1,4-N-acetylgalactosaminyl transferase 3 (beta4GalNAc-T3) and beta4GalNAc-T4.
22722937 Molecular basis for protein-specific transfer of N-acetylgalactosamine to N-linked glycans by the glycosyltransferases beta1,4-N-acetylgalactosaminyl transferase 3 (beta4GalNAc-T3) and beta4GalNAc-T4.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20360844 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18048353 betaGT3 and betaGT4, that are able to transfer GalNAc to GlcNAc in beta1,4-linkage display the necessary glycoprotein specificity in vivo.
17579116 up-regulation of beta4GalNAc-T3 may play a critical role in promoting tumor malignanc
16728562 supra-nuclear expression of beta4GalNAc-T3 is essential for the formation of LacdiNAc on the surface mucous cells and that LacdiNAc and beta4GalNAc-T3 are novel differentiation markers of surface mucous cells in the gastric mucosa.

AA Sequence

MGSPRAARPPLLLRPVKLLRRRFRLLLALAVVSVGLWTLYLELVASAQVGGNPLNRRYGSWRELAKALAS      1 - 70
RNIPAVDPHLQFYHPQRLSLEDHDIDQGVSSNSSYLKWNKPVPWLSEFRGRANLHVFEDWCGSSIQQLRR     71 - 140
NLHFPLYPHIRTTLRKLAVSPKWTNYGLRIFGYLHPFTDGKIQFAIAADDNAEFWLSLDDQVSGLQLLAS    141 - 210
VGKTGKEWTAPGEFGKFRSQISKPVSLSASHRYYFEVLHKQNEEGTDHVEVAWRRNDPGAKFTIIDSLSL    211 - 280
SLFTNETFLQMDEVGHIPQTAASHVDSSNALPRDEQPPADMLRPDPRDTLYRVPLIPKSHLRHVLPDCPY    281 - 350
KPSYLVDGLPLQRYQGLRFVHLSFVYPNDYTRLSHMETHNKCFYQENAYYQDRFSFQEYIKIDQPEKQGL    351 - 420
EQPGFEENLLEESQYGEVAEETPASNNQNARMLEGRQTPASTLEQDATDYRLRSLRKLLAQPREGLLAPF    421 - 490
SKRNSTASFPGRTSHIPVQQPEKRKQKPSPEPSQDSPHSDKWPPGHPVKNLPQMRGPRPRPAGDSPRKTQ    491 - 560
WLNQVESYIAEQRRGDRMRPQAPGRGWHGEEEVVAAAGQEGQVEGEEEGEEEEEEEDMSEVFEYVPVFDP    561 - 630
VVNWDQTFSARNLDFQALRTDWIDLSCNTSGNLLLPEQEALEVTRVFLKKLNQRSRGRYQLQRIVNVEKR    631 - 700
QDQLRGGRYLLELELLEQGQRVVRLSEYVSARGWQGIDPAGGEEVEARNLQGLVWDPHNRRRQVLNTRAQ    701 - 770
EPKLCWPQGFSWSHRAVVHFVVPVKNQARWVQQFIKDMENLFQVTGDPHFNIVITDYSSEDMDVEMALKR    771 - 840
SKLRSYQYVKLSGNFERSAGLQAGIDLVKDPHSIIFLCDLHIHFPAGVIDAIRKHCVEGKMAFAPMVMRL    841 - 910
HCGATPQWPEGYWEVNGFGLLGIYKSDLDRIGGMNTKEFRDRWGGEDWELLDRILQAGLDVERLSLRNFF    911 - 980
HHFHSKRGMWSRRQMKTL                                                        981 - 998
//

Text Mined References (13)

PMID Year Title
25803323 2015 New somatic mutations and WNK1-B4GALNT3 gene fusion in papillary thyroid carcinoma.
25003232 2014 ?1, 4-N-acetylgalactosaminyltransferase III modulates cancer stemness through EGFR signaling pathway in colon cancer cells.
22722940 2012 Peptide-specific transfer of N-acetylgalactosamine to O-linked glycans by the glycosyltransferases ?1,4-N-acetylgalactosaminyl transferase 3 (?4GalNAc-T3) and ?4GalNAc-T4.
22722937 2012 Molecular basis for protein-specific transfer of N-acetylgalactosamine to N-linked glycans by the glycosyltransferases ?1,4-N-acetylgalactosaminyl transferase 3 (?4GalNAc-T3) and ?4GalNAc-T4.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20360844 2010 Genome-wide association study identifies GPC5 as a novel genetic locus protective against sudden cardiac arrest.
18048353 2008 A necessary and sufficient determinant for protein-selective glycosylation in vivo.
17579116 2007 Beta1,4-N-acetylgalactosaminyltransferase III enhances malignant phenotypes of colon cancer cells.
16728562 2006 Apical Golgi localization of N,N'-diacetyllactosediamine synthase, beta4GalNAc-T3, is responsible for LacdiNAc expression on gastric mucosa.
16541075 2006 The finished DNA sequence of human chromosome 12.
More...