Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
psoriasis 6,685

Synonym

Accession Q6L8H2 Q6PL44 Q701N3
Symbols KRTAP5-9
KRTAP5.3

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MGCSGCSGGCGSSCGGCGSSCGGCGSGYGGCGSGCCVPVCCCKPVCCCVPACSCSSCGSCGGSKGVCGSC      1 - 70
GGCKGGCGSCGGSKGGCGSSCCVPVCCSSSCGSCGGSKGVCGFRGGSKGGCGSCGCSQCSCYKPCCCSSG     71 - 140
CGSSCCQSSCCKPSCSQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCG    141 - 210
SSCCQSSCCKPCSSQSSCCVPICCQCKI                                              211 - 238
//

Text Mined References (1)

PMID Year Title
15144888 2004 Identification of two novel clusters of ultrahigh-sulfur keratin-associated protein genes on human chromosome 11.