Property Summary

NCBI Gene PubMed Count 8
Grant Count 6
R01 Count 5
Funding $511,318.25
PubMed Score 10.02
PubTator Score 4.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 0.003
osteosarcoma -1.531 0.006
interstitial cystitis 2.200 0.004
primary Sjogren syndrome 2.100 0.000
lung carcinoma -1.800 0.000
psoriasis 1.300 0.000

Gene RIF (5)

PMID Text
20595294 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18247378 IFIXalpha suppressed the invasion activity of MDA-MB-468 breast cancer cells, and its inhibitory effect was reversed by the knockdown of maspin
16479015 IFIX alpha1 isoform functions as a tumor suppressor by repressing HDM2 function
15122330 a new member of the hematopoietic interferon (IFN)-inducible nuclear protein. Six different alternatively spliced forms are transcribed from the IFIX gene

AA Sequence

MANNYKKIVLLKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADLMEEKFPGDAGLGKLIEFFK      1 - 70
EIPTLGDLAETLKREKLKVANKIESIPVKGIIPSKKTKQKEVYPATPACTPSNRLTAKGAEETLGPQKRK     71 - 140
KPSEEETGTKRSKMSKEQTRPSCSAGASTSTAMGRSPPPQTSSSAPPNTSSTESLKPLANRHATASKNIF    141 - 210
REDPIIAMVLNATKVFKYESSENEQRRMFHATVATQTQFFHVKVLNINLKRKFIKKRIIIISNYSKRNSL    211 - 280
LEVNEASSVSEAGPDQTFEVPKDIIRRAKKIPKINILHKQTSGYIVYGLFMLHTKIVNRKTTIYEIQDKT    281 - 350
GSMAVVGKGECHNIPCEKGDKLRLFCFRLRKRENMSKLMSEMHSFIQIQKNTNQRSHDSRSMALPQEQSQ    351 - 420
HPKPSEASTTLPESHLKTPQMPPTTPSSSSFTKKDETHPGAQSSPANFRITSPTVAPPLSSDTSTNRHPA    421 - 490
VP                                                                        491 - 492
//

Text Mined References (10)

PMID Year Title
21804549 2011 Meta-analysis of genome-wide association studies of asthma in ethnically diverse North American populations.
20595294 2010 Association of IFI200 gene polymorphisms with susceptibility to systemic lupus erythematosus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18247378 2008 Interferon-inducible protein IFIXalpha inhibits cell invasion by upregulating the metastasis suppressor maspin.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16479015 2006 Interferon-inducible protein IFIXalpha1 functions as a negative regulator of HDM2.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15122330 2004 Antitumor activity of IFIX, a novel interferon-inducible HIN-200 gene, in breast cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.