Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.02
PubTator Score 4.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 9.3e-32
lung carcinoma 2843 2.2e-19
primary Sjogren syndrome 735 2.9e-04
cutaneous lupus erythematosus 1057 2.9e-03
interstitial cystitis 2312 3.9e-03
osteosarcoma 7950 6.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Asthma 385 0.0 3.0

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 2.9e-03
interstitial cystitis 2.200 3.9e-03
lung carcinoma -1.800 2.2e-19
osteosarcoma -1.531 6.2e-03
primary Sjogren syndrome 2.100 2.9e-04
psoriasis 1.300 9.3e-32

Gene RIF (6)

AA Sequence

MANNYKKIVLLKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADLMEEKFPGDAGLGKLIEFFK      1 - 70
EIPTLGDLAETLKREKLKVANKIESIPVKGIIPSKKTKQKEVYPATPACTPSNRLTAKGAEETLGPQKRK     71 - 140
KPSEEETGTKRSKMSKEQTRPSCSAGASTSTAMGRSPPPQTSSSAPPNTSSTESLKPLANRHATASKNIF    141 - 210
REDPIIAMVLNATKVFKYESSENEQRRMFHATVATQTQFFHVKVLNINLKRKFIKKRIIIISNYSKRNSL    211 - 280
LEVNEASSVSEAGPDQTFEVPKDIIRRAKKIPKINILHKQTSGYIVYGLFMLHTKIVNRKTTIYEIQDKT    281 - 350
GSMAVVGKGECHNIPCEKGDKLRLFCFRLRKRENMSKLMSEMHSFIQIQKNTNQRSHDSRSMALPQEQSQ    351 - 420
HPKPSEASTTLPESHLKTPQMPPTTPSSSSFTKKDETHPGAQSSPANFRITSPTVAPPLSSDTSTNRHPA    421 - 490
VP                                                                        491 - 492
//

Text Mined References (11)

PMID Year Title