Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.40
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MRQGLLVLALVLVLVLVLAAGSQVQEWYPRESHALNWNKFSGFWYILATATDAQGFLPARDKRKLGASVV      1 - 70
KVNKVGQLRVLLAFRRGQGCGRAQPRHPGTSGHLWASLSVKGVKAFHVLSTDYSYGLVYLRLGRATQNYK     71 - 140
NLLLFHRQNVSSFQSLKEFMDACDILGLSKAAVILPKDASRTHTILP                           141 - 187
//

Text Mined References (6)

PMID Year Title
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15363845 2004 Molecular evolution of epididymal lipocalin genes localized on mouse chromosome 2.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.