Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.40
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MRQGLLVLALVLVLVLVLAAGSQVQEWYPRESHALNWNKFSGFWYILATATDAQGFLPARDKRKLGASVV      1 - 70
KVNKVGQLRVLLAFRRGQGCGRAQPRHPGTSGHLWASLSVKGVKAFHVLSTDYSYGLVYLRLGRATQNYK     71 - 140
NLLLFHRQNVSSFQSLKEFMDACDILGLSKAAVILPKDASRTHTILP                           141 - 187
//

Text Mined References (6)

PMID Year Title